Canis lupus dingo (dingo): 112669195 Help Entry 112669195         CDS       T08371                                  Symbol CSTB Name (RefSeq) cystatin-B   KO K13907   cystatin-A/B Organism clud  Canis lupus dingo (dingo) Brite KEGG Orthology (KO) [BR:clud00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:clud01002]     112669195 (CSTB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clud04147]     112669195 (CSTB) Peptidases and inhibitors [BR:clud01002]  Peptidase inhibitors   Family I25: cystatin family    112669195 (CSTB) Exosome [BR:clud04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    112669195 (CSTB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin SQAPI Dynein_light DUF6195 Motif Other DBs NCBI-GeneID:  112669195 NCBI-ProteinID:  XP_025317888 Ensembl:  ENSCAFG00020018974 UniProt:  A0A8C0L3E5 LinkDB All DBs Position 31:complement(37539289..37989001) Genome browser AA seq 98 aa AA seqDB search MMCGAPSASQPATADTQAIADQVKAQLEERENKKYTTFKAVTFRSQVVAGTNYFIKVQVD DDEFVHLRVFQSLPHENKPLALSSYQTNKAKHDELAYF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatgtgcggggcgcccagcgcttcgcagcccgccacggccgacacccaggccatcgcc gaccaggtgaaggcccagctggaagagcgggaaaataagaagtacactacttttaaggcc gtgacattcaggagccaggtggtcgcggggacaaactacttcatcaaggtccaagttgac gatgacgaatttgtgcaccttcgagtatttcagagtctcccgcatgagaacaagcccttg gccttgtccagctatcagaccaacaaagccaagcacgacgagctggcgtacttctag

DBGET integrated database retrieval system