Canis lupus dingo (dingo): 112669459 Help Entry 112669459         CDS       T08371                                  Symbol HMGB1 Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism clud  Canis lupus dingo (dingo) Pathway clud03410   Base excision repair clud04140   Autophagy - animal clud04217   Necroptosis clud04613   Neutrophil extracellular trap formation Brite KEGG Orthology (KO) [BR:clud00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     112669459 (HMGB1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     112669459 (HMGB1)   09143 Cell growth and death    04217 Necroptosis     112669459 (HMGB1)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     112669459 (HMGB1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:clud03036]     112669459 (HMGB1)    03400 DNA repair and recombination proteins [BR:clud03400]     112669459 (HMGB1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clud04147]     112669459 (HMGB1) Chromosome and associated proteins [BR:clud03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     112669459 (HMGB1) DNA repair and recombination proteins [BR:clud03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      112669459 (HMGB1)    MMR (mismatch excision repair)     Other MMR factors      112669459 (HMGB1) Exosome [BR:clud04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    112669459 (HMGB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 NOA36 HMG_box_5 Nop14 Motif Other DBs NCBI-GeneID:  112669459 NCBI-ProteinID:  XP_025318369 Ensembl:  ENSCAFG00020025123 UniProt:  A0A8C0R7L8 LinkDB All DBs Position 25:9409754..9537547 Genome browser AA seq 215 aa AA seqDB search MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK SKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgggcaaaggagatcctaagaagccgagaggcaaaatgtcatcatatgcattctttgtg caaacttgccgagaggagcacaagaagaagcacccagatgcttcagtcaacttctcagag ttttctaagaagtgctcagaaaggtggaagaccatgtctgctaaagagaaaggaaaattt gaagacatggctaaggcggacaaggcccgttatgaaagagaaatgaaaacttatatcccc cctaaaggggaaacaaaaaagaagttcaaggatcccaatgcacccaagaggcctccctcg gcctttttcttgttttgttctgagtatcgcccaaaaatcaaaggagagcatcccggccta tccattggtgatgttgcaaagaaactgggagagatgtggaataacactgctgcagatgac aagcagccttatgaaaagaaggctgctaagctgaaggaaaaatatgaaaaggatattgct gcgtaccgagctaaaggaaagcctgatgcggcaaaaaagggagttgtcaaggctgaaaag agcaagaaaaagaaggaagaggaggaagacgaggaggatgaagaggatgaggaggaggaa gaagatgaagaagatgaagatgaagaagaagatgatgatgatgaataa

DBGET integrated database retrieval system