Canis lupus dingo (dingo): 112669538 Help Entry 112669538         CDS       T08371                                  Symbol FGF9 Name (RefSeq) fibroblast growth factor 9   KO K04358   fibroblast growth factor Organism clud  Canis lupus dingo (dingo) Pathway clud04010   MAPK signaling pathway clud04014   Ras signaling pathway clud04015   Rap1 signaling pathway clud04020   Calcium signaling pathway clud04151   PI3K-Akt signaling pathway clud04810   Regulation of actin cytoskeleton clud05200   Pathways in cancer clud05207   Chemical carcinogenesis - receptor activation clud05218   Melanoma clud05224   Breast cancer clud05226   Gastric cancer Brite KEGG Orthology (KO) [BR:clud00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112669538 (FGF9)    04014 Ras signaling pathway     112669538 (FGF9)    04015 Rap1 signaling pathway     112669538 (FGF9)    04020 Calcium signaling pathway     112669538 (FGF9)    04151 PI3K-Akt signaling pathway     112669538 (FGF9)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     112669538 (FGF9)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112669538 (FGF9)    05207 Chemical carcinogenesis - receptor activation     112669538 (FGF9)   09162 Cancer: specific types    05226 Gastric cancer     112669538 (FGF9)    05218 Melanoma     112669538 (FGF9)    05224 Breast cancer     112669538 (FGF9)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:clud04052]     112669538 (FGF9)    00536 Glycosaminoglycan binding proteins [BR:clud00536]     112669538 (FGF9) Cytokines and neuropeptides [BR:clud04052]  Cytokines   Growth factors (RTK binding)    112669538 (FGF9) Glycosaminoglycan binding proteins [BR:clud00536]  Heparan sulfate / Heparin   Growth factors/receptors    112669538 (FGF9) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  112669538 NCBI-ProteinID:  XP_025318506 Ensembl:  ENSCAFG00020025429 UniProt:  A0A8C0LJ06 LinkDB All DBs Position 25:complement(16620256..16655798) Genome browser AA seq 208 aa AA seqDB search MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGI LRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNE KGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKR HQKFTHFLPRPVDPDKVPELYKDILSQS NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggctcccttaggtgaagttgggaactatttcggtgtgcaggatgcggtaccgtttggg aatgtgcccgtgttgccggtggacagtccggttttgttaagtgaccacctgggtcagtcc gaagcaggggggcttcccaggggacccgcagtcacagacttggatcatttaaaggggatt ctcaggcggaggcagctatactgcaggactggatttcacttagaaatcttccccaatggt actatccagggaaccaggaaagaccacagccgattcggcattctggaatttatcagtata gcagtgggcctggtcagcattcgaggcgtggacagtggactctacctcgggatgaatgag aagggagagctgtatggatcagaaaaactaacccaagagtgtgtattcagagaacagttt gaagaaaactggtataacacgtactcttcgaatctatataaacacgtggacactggaagg cgatactatgttgcattaaataaagacgggaccccaagagaaggaacgaggactaaacgg caccagaaattcacccattttttacctagaccagtggaccccgacaaagtacccgaacta tataaggatattctaagccaaagttga

DBGET integrated database retrieval system