Canis lupus dingo (dingo): 112670793 Help Entry 112670793         CDS       T08371                                  Symbol CAV1 Name (RefSeq) caveolin-1 isoform X1   KO K06278   caveolin 1 Organism clud  Canis lupus dingo (dingo) Pathway clud04144   Endocytosis clud04510   Focal adhesion clud05020   Prion disease clud05100   Bacterial invasion of epithelial cells clud05205   Proteoglycans in cancer clud05416   Viral myocarditis clud05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:clud00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     112670793 (CAV1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     112670793 (CAV1)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     112670793 (CAV1)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     112670793 (CAV1)   09164 Neurodegenerative disease    05020 Prion disease     112670793 (CAV1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     112670793 (CAV1)    05416 Viral myocarditis     112670793 (CAV1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:clud04131]     112670793 (CAV1) Membrane trafficking [BR:clud04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     112670793 (CAV1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  112670793 NCBI-ProteinID:  XP_025320523 Ensembl:  ENSCAFG00020007358 LinkDB All DBs Position 14:55367586..55403225 Genome browser AA seq 147 aa AA seqDB search MAEEMSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTT FTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIY VHTFCDPFFEAVGKIFSNIRINMQKET NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atggcggaggagatgagcgagaagcaggtgtacgacgcgcacaccaaggaaatcgacctg gtcaaccgcgaccccaagcatctcaacgacgacgtggtcaagattgattttgaagatgtg attgcagaaccagaaggaacacacagttttgatggcatctggaaggccagcttcaccacc ttcactgtgacaaaatactggttttaccgcttgctgtctgccctctttggcatcccaatg gcactcatatggggcatttactttgccattctttctttcctgcacatctgggcagttgtg ccgtgcattaagagtttcctgattgagattcagtgcatcagccgtgtctattccatctac gtccacaccttctgtgacccgttctttgaggctgttggcaaaatattcagcaatatccgc atcaacatgcagaaagaaacataa

DBGET integrated database retrieval system