Canis lupus dingo (dingo): 112674430 Help Entry 112674430         CDS       T08371                                  Name (RefSeq) histone H4-like   KO K11254   histone H4 Organism clud  Canis lupus dingo (dingo) Pathway clud04613   Neutrophil extracellular trap formation clud05034   Alcoholism clud05203   Viral carcinogenesis clud05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:clud00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     112674430  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     112674430   09163 Immune disease    05322 Systemic lupus erythematosus     112674430   09165 Substance dependence    05034 Alcoholism     112674430  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:clud03036]     112674430 Chromosome and associated proteins [BR:clud03036]  Eukaryotic type   Nucleosome assembly factors    Histones     112674430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP Motif Other DBs NCBI-GeneID:  112674430 NCBI-ProteinID:  XP_025326681 LinkDB All DBs Position 35:25167718..25169826 Genome browser AA seq 131 aa AA seqDB search MPLFGVVSVTVNVYAQQLLLAQANVSLSSLGRGKGGKGLGKGGAKRHRKVLRDNIQGITK PAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALK RQGRTLYGFGG NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atgcctctttttggtgttgtatcagtgacagtgaatgtatatgcacaacagttattgctg gcacaggcgaatgtgtctctcagctcgttgggtcgcggcaagggcgggaaggggctgggc aagggcggcgccaagcgccaccgcaaggtgctgcgcgacaacatccagggcatcaccaag cccgccatccggcggctggcccggcgcggcggcgtcaagcgcatctcgggcctcatctac gaggagacccgcggggtgctcaaggtgttcctggagaacgtgatccgggacgccgtcacc tacacggagcacgccaagcgcaagacggtcacggccatggacgtggtctacgcgctcaag cgccagggccgcaccctctacggcttcggcggctga

DBGET integrated database retrieval system