Canis lupus dingo (dingo): 112676011 Help Entry 112676011         CDS       T08371                                  Symbol B2M Name (RefSeq) beta-2-microglobulin isoform X4   KO K08055   beta-2-microglobulin Organism clud  Canis lupus dingo (dingo) Pathway clud04612   Antigen processing and presentation clud05163   Human cytomegalovirus infection clud05166   Human T-cell leukemia virus 1 infection clud05168   Herpes simplex virus 1 infection clud05169   Epstein-Barr virus infection clud05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:clud00001]  09150 Organismal Systems   09151 Immune system    04612 Antigen processing and presentation     112676011 (B2M)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     112676011 (B2M)    05170 Human immunodeficiency virus 1 infection     112676011 (B2M)    05168 Herpes simplex virus 1 infection     112676011 (B2M)    05163 Human cytomegalovirus infection     112676011 (B2M)    05169 Epstein-Barr virus infection     112676011 (B2M)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clud04147]     112676011 (B2M) Exosome [BR:clud04147]  Exosomal proteins   Exosomal proteins of breast milk    112676011 (B2M) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  C1-set Ig_3 Ig_2 C2-set_2 I-set Cna_B Motif Other DBs NCBI-GeneID:  112676011 NCBI-ProteinID:  XP_025328728 Ensembl:  ENSCAFG00020022164 UniProt:  A0A8C0LC59 LinkDB All DBs Position 30:11507166..11513453 Genome browser AA seq 125 aa AA seqDB search MAPRPALATAGFLALLLILLAACRLDAVQHPPKIQVYSRHPAENGKPNFLNCYVSGFHPP EIEIDLLKNGKEMKAEQTDLSFSKDWTFYLLVHTEFTPNEQDEFSCRVKHVTLSEPQIVK WDRDN NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atggctccgcgtcccgcgctggcgacggctggtttcctggccttgctcctcatcctcctc gctgcgtgccgcctggatgccgtgcagcatcccccaaagattcaagtgtactcacgacac ccagcagagaatggaaagccaaatttcctgaactgctacgtgtcagggttccatccacca gagattgaaattgatttgttgaagaacggaaaggagatgaaagcagaacagacagacctg tctttcagcaaggactggaccttctatcttctggtccacactgaattcactcccaatgag caggatgagtttagctgccgtgtaaagcatgttactctcagtgagccccagatcgttaag tgggaccgagacaactga

DBGET integrated database retrieval system