Canis lupus dingo (dingo): 112677012 Help Entry 112677012         CDS       T08371                                  Symbol CRKL Name (RefSeq) crk-like protein isoform X1   KO K04438   C-crk adapter molecule crk Organism clud  Canis lupus dingo (dingo) Pathway clud04010   MAPK signaling pathway clud04012   ErbB signaling pathway clud04015   Rap1 signaling pathway clud04062   Chemokine signaling pathway clud04148   Efferocytosis clud04510   Focal adhesion clud04666   Fc gamma R-mediated phagocytosis clud04722   Neurotrophin signaling pathway clud04810   Regulation of actin cytoskeleton clud04910   Insulin signaling pathway clud04935   Growth hormone synthesis, secretion and action clud05100   Bacterial invasion of epithelial cells clud05135   Yersinia infection clud05163   Human cytomegalovirus infection clud05170   Human immunodeficiency virus 1 infection clud05200   Pathways in cancer clud05206   MicroRNAs in cancer clud05211   Renal cell carcinoma clud05220   Chronic myeloid leukemia Brite KEGG Orthology (KO) [BR:clud00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112677012 (CRKL)    04012 ErbB signaling pathway     112677012 (CRKL)    04015 Rap1 signaling pathway     112677012 (CRKL)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     112677012 (CRKL)   09144 Cellular community - eukaryotes    04510 Focal adhesion     112677012 (CRKL)   09142 Cell motility    04810 Regulation of actin cytoskeleton     112677012 (CRKL)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     112677012 (CRKL)    04062 Chemokine signaling pathway     112677012 (CRKL)   09152 Endocrine system    04910 Insulin signaling pathway     112677012 (CRKL)    04935 Growth hormone synthesis, secretion and action     112677012 (CRKL)   09156 Nervous system    04722 Neurotrophin signaling pathway     112677012 (CRKL)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112677012 (CRKL)    05206 MicroRNAs in cancer     112677012 (CRKL)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     112677012 (CRKL)    05211 Renal cell carcinoma     112677012 (CRKL)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112677012 (CRKL)    05163 Human cytomegalovirus infection     112677012 (CRKL)   09171 Infectious disease: bacterial    05135 Yersinia infection     112677012 (CRKL)    05100 Bacterial invasion of epithelial cells     112677012 (CRKL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SH3_2 SH2 SH3_1 SH3_9 hSH3 Motif Other DBs NCBI-GeneID:  112677012 NCBI-ProteinID:  XP_035562169 Ensembl:  ENSCAFG00020009010 LinkDB All DBs Position 26:complement(29798546..29839203) Genome browser AA seq 303 aa AA seqDB search MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPT AEENLEYVRTLYDFLGNDAEDLPFKKGEILVIIEKPEEQWWSARNKEGRIGMIPVPYVEK LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSSTPGAAINPLPSTQNGPVFA KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIIDPQNPD ENE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atgtcctccgccaggttcgactcctcagaccgctccgcctggtacatggggccggtgtct cgccaggaggcgcagacccggctgcagggccagcgccacggaatgttcctagttcgcgat tcctccacctgccctggggattatgtgctgtcggtgtccgagaactcgcgggtctcccac tacatcatcaactcgctgcccaaccgccgttttaagatcggggaccaggagtttgaccac ttgccggccctgctggagttctacaagatccactacctggacaccaccaccctaatcgag cccgcgcccaggtacccaagcccaccaatgggatctgtatcagcacccaacctgcctaca gcagaagaaaatctggaatatgtacggactctctatgattttcttgggaatgatgctgaa gacctgccctttaaaaagggtgagatcctggtgataatagagaagcctgaagaacagtgg tggagtgcccggaacaaggagggccggattgggatgattcctgttccttatgttgaaaag cttgtgagatcctcaccacatggaaagcacgggaataggaattccaacagttacggaatc ccagaacctgctcatgcatatgctcaacctcagaccacaactcctctacctgcagtttcc agtactcctggggcagcgatcaaccctttgccatccacacagaatggacctgtctttgca aaagccatccagaaaagagtaccctgtgcttatgacaagaccgccttggcattagaggtt ggtgacattgtgaaagtcacaaggatgaatataaatggccaatgggaaggcgaagtgaat gggcgcaaagggcttttcccctttacgcatgtcaaaatcattgaccctcaaaaccctgat gaaaacgagtga

DBGET integrated database retrieval system