Canis lupus dingo (dingo): 112677108 Help Entry 112677108         CDS       T08371                                  Name (RefSeq) glutathione S-transferase P-like   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism clud  Canis lupus dingo (dingo) Pathway clud00480   Glutathione metabolism clud00980   Metabolism of xenobiotics by cytochrome P450 clud00982   Drug metabolism - cytochrome P450 clud00983   Drug metabolism - other enzymes clud01100   Metabolic pathways clud01524   Platinum drug resistance clud05200   Pathways in cancer clud05204   Chemical carcinogenesis - DNA adducts clud05215   Prostate cancer clud05225   Hepatocellular carcinoma clud05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:clud00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     112677108   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     112677108    00982 Drug metabolism - cytochrome P450     112677108    00983 Drug metabolism - other enzymes     112677108  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112677108    05204 Chemical carcinogenesis - DNA adducts     112677108   09162 Cancer: specific types    05225 Hepatocellular carcinoma     112677108    05215 Prostate cancer     112677108   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     112677108   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     112677108  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:clud02000]     112677108 Enzymes [BR:clud01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      112677108 Transporters [BR:clud02000]  Other transporters   Pores ion channels [TC:1]    112677108 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_7 Motif Other DBs NCBI-GeneID:  112677108 NCBI-ProteinID:  XP_035576859 Ensembl:  ENSCAFG00020008637 LinkDB All DBs Position 9:complement(48227127..48227885) Genome browser AA seq 210 aa AA seqDB search MPPYTIIYFPVRGRCEAMHMLLADQGQSWKEEVVTMETWMKGSLKASCLYGQLPKFQDGD LTLYQSNAILRQLGRSLGLYGKDQQEAALLDVVNDGVEDLRCKYALLIYTNYEAGKEEYV KALPGYLKPFETLLSQNEGGQAFIVENQISFADYNLLDLLLIHQVLAPSCLDSFPLLSAY VARLSTRPKLKAFLSSPEHVNRPINGNGKQ NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgccaccctacaccatcatctacttccctgttcgagggcgctgtgaggccatgcacatg ctgctggctgaccagggccagagctggaaggaggaggtggtgaccatggagacctggatg aagggctcactcaaggcctcctgtctgtacgggcagctccccaagttccaggacggagac ctcaccctgtaccagtccaatgccatcctgagacagctgggccgctcccttgggctctac gggaaggaccagcaggaagcggccttgctggatgtagtgaacgatggtgtggaggatctc cgctgcaaatacgccctcctcatctacactaactatgaggcaggaaaggaggagtatgtg aaggcactaccaggttacctgaagccttttgaaacgctgttgtcccagaatgaggggggc caggccttcatcgtggaaaaccagatctccttcgcggactacaacctgctggacttgctg ctgattcaccaggtcctggcccccagctgcctggactccttccccctgctctcggcctat gtggcgcgcctcagcaccagacccaagctcaaggcattcctgtcgtcccccgagcacgtg aaccgccccatcaatggcaatgggaagcagtga

DBGET integrated database retrieval system