Canis lupus dingo (dingo): 112679101 Help Entry 112679101         CDS       T08371                                  Name (RefSeq) cofilin-1-like   KO K05765   cofilin Organism clud  Canis lupus dingo (dingo) Pathway clud04360   Axon guidance clud04666   Fc gamma R-mediated phagocytosis clud04810   Regulation of actin cytoskeleton clud05133   Pertussis clud05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:clud00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     112679101  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     112679101   09158 Development and regeneration    04360 Axon guidance     112679101  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112679101   09171 Infectious disease: bacterial    05133 Pertussis     112679101  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:clud04131]     112679101   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:clud04812]     112679101    04147 Exosome [BR:clud04147]     112679101 Membrane trafficking [BR:clud04131]  Others   Actin-binding proteins    Others     112679101 Cytoskeleton proteins [BR:clud04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      112679101 Exosome [BR:clud04147]  Exosomal proteins   Proteins found in most exosomes    112679101 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cofilin_ADF RXYLT1_N Motif Other DBs NCBI-GeneID:  112679101 NCBI-ProteinID:  XP_035573555 LinkDB All DBs Position 6:49476026..49476649 Genome browser AA seq 142 aa AA seqDB search MFNDMKVRKSSTPEEVKKRKKSVLLCLGEDKKNILEEAKEILVGDVGQTVHDPHATFVKM LPDKDCRYALYDTTYESKKEDLVFTFWAPESAPLKSKMIYASSKDAIKKKLTRIKHELQA NCYKEVKKLGGSAVISLEGKPL NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atgttcaatgacatgaaggtgcgtaaatcctcaacaccagaggaggtgaagaagcgcaag aagtcagtacttctctgcctgggcgaggacaagaagaacatcctcgaggaggccaaggag atcctggtaggtgatgtgggccagactgtgcacgacccacacgccacctttgtcaagatg ctaccagacaaggactgccgctatgccctctatgacacaacctatgagagcaagaaggag gacctggtgtttaccttctgggcacctgagtctgcaccccttaagagcaaaatgatttat gccagttccaaggatgccatcaagaagaagctgaccaggatcaagcatgaattacaagca aactgctacaaggaggtcaagaaattggggggcagtgccgtcatctctctggagggcaag cctttatga

DBGET integrated database retrieval system