Canis lupus dingo (dingo): 118350181 Help Entry 118350181         CDS       T08371                                  Name (RefSeq) interferon alpha-1/2-like   KO K05414   interferon alpha Organism clud  Canis lupus dingo (dingo) Pathway clud04060   Cytokine-cytokine receptor interaction clud04151   PI3K-Akt signaling pathway clud04217   Necroptosis clud04620   Toll-like receptor signaling pathway clud04621   NOD-like receptor signaling pathway clud04622   RIG-I-like receptor signaling pathway clud04623   Cytosolic DNA-sensing pathway clud04630   JAK-STAT signaling pathway clud04650   Natural killer cell mediated cytotoxicity clud04936   Alcoholic liver disease clud05152   Tuberculosis clud05160   Hepatitis C clud05161   Hepatitis B clud05162   Measles clud05163   Human cytomegalovirus infection clud05164   Influenza A clud05165   Human papillomavirus infection clud05167   Kaposi sarcoma-associated herpesvirus infection clud05168   Herpes simplex virus 1 infection clud05169   Epstein-Barr virus infection clud05170   Human immunodeficiency virus 1 infection clud05171   Coronavirus disease - COVID-19 clud05200   Pathways in cancer clud05320   Autoimmune thyroid disease clud05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:clud00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     118350181    04151 PI3K-Akt signaling pathway     118350181   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     118350181  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     118350181  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     118350181    04621 NOD-like receptor signaling pathway     118350181    04622 RIG-I-like receptor signaling pathway     118350181    04623 Cytosolic DNA-sensing pathway     118350181    04650 Natural killer cell mediated cytotoxicity     118350181  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118350181   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     118350181    05161 Hepatitis B     118350181    05160 Hepatitis C     118350181    05171 Coronavirus disease - COVID-19     118350181    05164 Influenza A     118350181    05162 Measles     118350181    05168 Herpes simplex virus 1 infection     118350181    05163 Human cytomegalovirus infection     118350181    05167 Kaposi sarcoma-associated herpesvirus infection     118350181    05169 Epstein-Barr virus infection     118350181    05165 Human papillomavirus infection     118350181   09171 Infectious disease: bacterial    05152 Tuberculosis     118350181   09163 Immune disease    05320 Autoimmune thyroid disease     118350181   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     118350181   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     118350181  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:clud04052]     118350181 Cytokines and neuropeptides [BR:clud04052]  Cytokines   Interferons    118350181 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  118350181 NCBI-ProteinID:  XP_048972141 LinkDB All DBs Position 11:complement(40163228..40163791) Genome browser AA seq 187 aa AA seqDB search MALPCSFSVALVLLSCHSLCCLACHLPDTHGLRNWRVLTLLGQMRRLSAGSCDHYTNDFA FPKELFDGQRLQEAQALSVVHVMTQKVFHLFCPDTSSAPWNMTLLEELCSGLSEQLDDLE ACLLQEAGLAETPLMHEDSTLRTYFQRISLYLQDRNHSPCAWEMVRAEIGRSFFSSTILQ ERIRRRK NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atggccctgccctgctccttctcggtggccctggtgctgctcagctgccactccctgtgc tgtctggcttgccacctgcccgacacccacggcctgcgcaactggagggtcctgacgctc ctgggacagatgaggagactctccgccggctcttgtgaccactacaccaatgactttgcc ttccccaaggagctgtttgatggccagcggctccaggaggcgcaggccctctctgtggtc cacgtgatgacccagaaggtcttccacctcttctgcccggacacgtcctctgctccttgg aacatgactctcctggaggaactgtgctcggggctctctgagcagctggatgacctggag gcctgtctcctgcaggaggcggggctggccgagacccccctcatgcatgaggactccacc ctgaggacctacttccaaaggatctccctctacctgcaggacaggaaccacagcccgtgt gcctgggagatggtccgagcagaaatcgggagatccttcttctcctcgacaatcttgcaa gaaagaatcaggaggaggaaatga

DBGET integrated database retrieval system