Canis lupus dingo (dingo): 118353184 Help Entry 118353184         CDS       T08371                                  Name (RefSeq) protein S100-A10-like   KO K17274   protein S100-A10 Organism clud  Canis lupus dingo (dingo) Pathway clud04382   Cornified envelope formation clud05132   Salmonella infection Brite KEGG Orthology (KO) [BR:clud00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     118353184  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118353184  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clud04147]     118353184 Exosome [BR:clud04147]  Exosomal proteins   Exosomal proteins of microglial cells    118353184 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EFhand_Ca_insen EF-hand_1 PBP_dimer_2 Motif Other DBs NCBI-GeneID:  118353184 NCBI-ProteinID:  XP_035565902 UniProt:  A0A8C0K6P6 LinkDB All DBs Position 33:11845637..11845930 Genome browser AA seq 97 aa AA seqDB search MPSQMEHVMETMMFTFHKFAGVRGYLTKEDLRILIEKEFPGFLENQKDPLAMDKIMKDLG QCQDGKVDFQSFFSLIPRLTIACNDYFVIQMKQKGRK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccctctcaaatggagcatgtcatggaaaccatgatgttcacatttcacaaatttgct ggggttagaggctatttaacaaaggaggacctgagaatactcatagaaaaggagtttcct gggtttttagaaaatcaaaaagaccctctggccatggacaaaataatgaaggacctaggc cagtgccaagatggcaaagtggacttccagagcttcttttcactaattcctaggctcacc atcgcatgcaatgactattttgtaatacagatgaaacagaagggaaggaagtag

DBGET integrated database retrieval system