Canis lupus dingo (dingo): 125752927 Help Entry 125752927         CDS       T08371                                  Name (RefSeq) histone H2B type 2-K1-like   KO K11252   histone H2B Organism clud  Canis lupus dingo (dingo) Pathway clud04613   Neutrophil extracellular trap formation clud05034   Alcoholism clud05203   Viral carcinogenesis clud05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:clud00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     125752927  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     125752927   09163 Immune disease    05322 Systemic lupus erythematosus     125752927   09165 Substance dependence    05034 Alcoholism     125752927  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:clud03036]     125752927   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clud04147]     125752927 Chromosome and associated proteins [BR:clud03036]  Eukaryotic type   Nucleosome assembly factors    Histones     125752927 Exosome [BR:clud04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125752927 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  125752927 NCBI-ProteinID:  XP_048952519 UniProt:  A0A8C0JL33 LinkDB All DBs Position 18:complement(49154933..49155301) Genome browser AA seq 122 aa AA seqDB search MGTEHGQQPQSGGRRGHGSGDKKSKKHSRRKETYSMYIYKVLKQVHPDIGIFSKAMSIMN SFVNDVFERLAGKAAQLAQYLGQTTLTSWEVQTAVRWLLPGELAKHAISEGTKAITKYTG SK NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgggcaccgagcatgggcagcagccacagtctgggggccgcaggggacatggttctggt gataaaaagtccaaaaagcatagccggcgcaaggaaacatactcaatgtatatctacaag gtgctaaagcaggtgcaccctgacatcggcatcttttccaaggccatgagcatcatgaac tcgtttgtgaacgatgtgtttgaacggctggctggcaaagctgcccagctggcccagtac ttgggccagaccacactgacatcctgggaggtccagacggcggtgcgttggctactgcct ggggagctggccaagcatgccatatctgagggcaccaaggccatcaccaagtacaccggc tccaagtga

DBGET integrated database retrieval system