Canis lupus dingo (dingo): 125754036 Help Entry 125754036         CDS       T08371                                  Name (RefSeq) metallothionein-1   KO K14739   metallothionein 1/2 Organism clud  Canis lupus dingo (dingo) Pathway clud04978   Mineral absorption Brite KEGG Orthology (KO) [BR:clud00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     125754036  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:clud03019]     125754036    03029 Mitochondrial biogenesis [BR:clud03029]     125754036 Messenger RNA biogenesis [BR:clud03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      125754036 Mitochondrial biogenesis [BR:clud03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     125754036 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  125754036 NCBI-ProteinID:  XP_048960144 LinkDB All DBs Position 2:complement(58123697..58125425) Genome browser AA seq 61 aa AA seqDB search MDPDCSCSTGGSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccgactgctcctgctccaccggtggctcctgcacgtgcgctggctcctgcaaa tgcaaggagtgcaaatgcacctcctgcaagaagagttgctgctcctgctgccccgtgggc tgtgccaagtgtgcccagggctgcatctgcaagggtgcgtcggacaagtgcagctgctgt gcctga

DBGET integrated database retrieval system