Canis lupus dingo (dingo): 125754361 Help Entry 125754361         CDS       T08371                                  Name (RefSeq) histone H2A type 1-E   KO K11251   histone H2A Organism clud  Canis lupus dingo (dingo) Pathway clud03082   ATP-dependent chromatin remodeling clud04217   Necroptosis clud04613   Neutrophil extracellular trap formation clud05034   Alcoholism clud05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:clud00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     125754361  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     125754361  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     125754361  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     125754361   09165 Substance dependence    05034 Alcoholism     125754361  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:clud03036]     125754361   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clud04147]     125754361 Chromosome and associated proteins [BR:clud03036]  Eukaryotic type   Nucleosome assembly factors    Histones     125754361 Exosome [BR:clud04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125754361 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  125754361 NCBI-ProteinID:  XP_048961856 LinkDB All DBs Position 35:complement(24283050..24284405) Genome browser AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK TESHHKAKGK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtcgggacgcgggaagcagggcggcaaggctcgcgccaaggccaagacgcgctcgtcg cgggccgggctccagttcccggtgggccgcgtccaccgcctgctccgcaagggcaactac gcggagcgggtcggggcgggcgcgccggtgtacctggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc gtgaccatcgcgcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag accgagagccaccacaaggccaagggaaagtaa

DBGET integrated database retrieval system