Corynebacterium lujinxingii: IAU68_03035 Help Entry IAU68_03035       CDS       T07743                                  Name (GenBank) NrdH-redoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism cluj  Corynebacterium lujinxingii Brite KEGG Orthology (KO) [BR:cluj00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     IAU68_03035 Enzymes [BR:cluj01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      IAU68_03035 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Thioredoxin GST_N_3 GST_N_2 Thioredoxin_9 Glrx-like Motif Other DBs NCBI-ProteinID:  QNP90757 UniProt:  A0A7H0K0E1 LinkDB All DBs Position complement(622636..622920) Genome browser AA seq 94 aa AA seqDB search MSVKTPETNAAVTIFAADWCPFCRKLRERLDRTETPYDLVDVEAGGMDEVNEWIMSVNDG NRIVPTVLYSDGTHATNPEASAVRAKLRELTGEE NT seq 285 nt NT seq  +upstreamnt  +downstreamnt gtgtctgtgaaaacccccgaaaccaacgccgctgtgactattttcgccgccgactggtgc ccgttctgccgcaaactgcgcgagcgcctcgaccgcaccgaaaccccctacgacctcgtc gacgtcgaagctggcggcatggacgaggtcaacgagtggatcatgtccgtcaacgacggc aaccgcatcgtgcccaccgtgctctactccgacggcacccacgccaccaacccggaggcc tccgccgtacgcgccaagctgcgcgaactcaccggcgaggagtag

DBGET integrated database retrieval system