Cyclopterus lumpus (lumpfish): 117726294 Help Entry 117726294         CDS       T09199                                  Symbol calml4a Name (RefSeq) calmodulin-like protein 4a   KO K02183   calmodulin Organism clum  Cyclopterus lumpus (lumpfish) Pathway clum04020   Calcium signaling pathway clum04070   Phosphatidylinositol signaling system clum04114   Oocyte meiosis clum04218   Cellular senescence clum04261   Adrenergic signaling in cardiomyocytes clum04270   Vascular smooth muscle contraction clum04371   Apelin signaling pathway clum04625   C-type lectin receptor signaling pathway clum04744   Phototransduction clum04910   Insulin signaling pathway clum04912   GnRH signaling pathway clum04916   Melanogenesis Brite KEGG Orthology (KO) [BR:clum00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     117726294 (calml4a)    04020 Calcium signaling pathway     117726294 (calml4a)    04070 Phosphatidylinositol signaling system     117726294 (calml4a)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     117726294 (calml4a)    04218 Cellular senescence     117726294 (calml4a)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     117726294 (calml4a)   09152 Endocrine system    04910 Insulin signaling pathway     117726294 (calml4a)    04912 GnRH signaling pathway     117726294 (calml4a)    04916 Melanogenesis     117726294 (calml4a)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     117726294 (calml4a)    04270 Vascular smooth muscle contraction     117726294 (calml4a)   09157 Sensory system    04744 Phototransduction     117726294 (calml4a)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:clum01009]     117726294 (calml4a)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:clum04131]     117726294 (calml4a)    03036 Chromosome and associated proteins [BR:clum03036]     117726294 (calml4a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clum04147]     117726294 (calml4a) Protein phosphatases and associated proteins [BR:clum01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      117726294 (calml4a) Membrane trafficking [BR:clum04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     117726294 (calml4a) Chromosome and associated proteins [BR:clum03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      117726294 (calml4a) Exosome [BR:clum04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    117726294 (calml4a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_9 AIF-1 p25-alpha MTIP_N FlgD GPHH B EF-hand_11 Motif Other DBs NCBI-GeneID:  117726294 NCBI-ProteinID:  XP_034382383 Ensembl:  ENSCLMG00005021342 LinkDB All DBs Position 3:complement(24541921..24546134) Genome browser AA seq 153 aa AA seqDB search MAKFFTPVQINEFKECFSLYDKKRKGKIVVKDLITVMRCLGTSPTFGEIERHLQVHKIEK AGELDFSTFLTMMHRQMQQEDPKTEILEALRMTDKQKNGYIQASELRAKLTLLGEKLTNK EVDELFKEANVKSNGVVNYEEFTHMVTLPPVDY NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggccaaattcttcacaccagttcaaatcaacgagttcaaagagtgcttctccttgtac gacaagaaacgaaagggcaagattgttgtcaaagacctgatcacagttatgcgctgcctg ggtacgagccccacgttcggagaaatcgaaagacatctacaagttcacaaaatcgaaaag gccggtgagctggacttctctacgtttctgacgatgatgcacagacagatgcagcaggaa gaccccaagacagaaatcctggaggccttgaggatgacggacaaacagaagaacggttac atccaggcgtctgagctgcgggccaagctcaccttgttgggggagaaactcacaaacaaa gaagtggacgagctcttcaaagaggcaaacgtcaagtcaaacggggtcgtcaactatgaa gaattcacgcacatggtgacgctgccgcctgtggattactga

DBGET integrated database retrieval system