Cyclopterus lumpus (lumpfish): 117730732 Help Entry 117730732         CDS       T09199                                  Symbol gnrh2 Name (RefSeq) progonadoliberin-2   KO K05252   gonadotropin-releasing hormone Organism clum  Cyclopterus lumpus (lumpfish) Pathway clum04080   Neuroactive ligand-receptor interaction clum04081   Hormone signaling clum04912   GnRH signaling pathway Brite KEGG Orthology (KO) [BR:clum00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     117730732 (gnrh2)    04081 Hormone signaling     117730732 (gnrh2)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     117730732 (gnrh2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:clum04052]     117730732 (gnrh2) Cytokines and neuropeptides [BR:clum04052]  Neuropeptides   GPCR binding    117730732 (gnrh2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GnRH Motif Other DBs NCBI-GeneID:  117730732 NCBI-ProteinID:  XP_034388568 Ensembl:  ENSCLMG00005016392 UniProt:  A0A8C3A0H1 LinkDB All DBs Position 5:1636462..1637176 Genome browser AA seq 85 aa AA seqDB search MRVPRLLLLLGLLLCVGAQPSDAQHWSHGWYPGGKRELDSFGPAEISEEIKLCEAGECSY LRPQRRNVLRSIILDALARELQKRK NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcgtgttcctcggctgctgctgctgctcgggctgcttctctgcgtgggagctcagccc tctgacgcccagcactggtcccacggctggtaccccggaggcaagagggagctggactcc ttcggcccggcggagatttcagaggagatcaagctgtgtgaggctggagaatgcagctac ttgagaccccagaggaggaatgttctgagaagcatcattttggatgccttagccagagag ctccagaagagaaagtga

DBGET integrated database retrieval system