Cyclopterus lumpus (lumpfish): 117730804 Help Entry 117730804         CDS       T09199                                  Symbol brk1 Name (RefSeq) probable protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism clum  Cyclopterus lumpus (lumpfish) Pathway clum04810   Regulation of actin cytoskeleton clum05132   Salmonella infection Brite KEGG Orthology (KO) [BR:clum00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     117730804 (brk1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117730804 (brk1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  117730804 NCBI-ProteinID:  XP_034388688 Ensembl:  ENSCLMG00005018643 LinkDB All DBs Position 5:16092936..16094301 Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggctggccaggaagatccagtgcaaagggagattcaccaagattgggcgaatcgagag tacatcgaagttattacgagcagcataaaaaaaatcgccgactttctcaactcatttgat atgtcgtgtcgatcccgcttggccaccctcaatgagaagctgactgctttggagaggagg attgaatatattgaggcgagagtgacgaaaggagagactttgacctag

DBGET integrated database retrieval system