Cyclopterus lumpus (lumpfish): 117732337 Help Entry 117732337         CDS       T09199                                  Name (RefSeq) metallothionein B-like   KO K14739   metallothionein 1/2 Organism clum  Cyclopterus lumpus (lumpfish) Brite KEGG Orthology (KO) [BR:clum00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:clum03019]     117732337    03029 Mitochondrial biogenesis [BR:clum03029]     117732337 Messenger RNA biogenesis [BR:clum03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      117732337 Mitochondrial biogenesis [BR:clum03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     117732337 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  117732337 NCBI-ProteinID:  XP_034391119 Ensembl:  ENSCLMG00005021844 UniProt:  A0A8C3AVP2 LinkDB All DBs Position 6:complement(20510693..20512210) Genome browser AA seq 60 aa AA seqDB search MDPCDCSKSGTCNCGGSCTCKNCSCTTCKKSCCPCCPSSCNKCASGCVCEGKTCDTSCCQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggacccttgcgattgctccaagagtggcacctgcaactgtggaggatcctgcacttgc aaaaactgctcctgcaccacctgcaagaagagctgctgcccatgctgcccatccagctgc aacaaatgcgcctctggctgcgtgtgcgaagggaagacgtgtgacaccagctgctgccag tga

DBGET integrated database retrieval system