Cyclopterus lumpus (lumpfish): 117734871 Help Entry 117734871         CDS       T09199                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism clum  Cyclopterus lumpus (lumpfish) Pathway clum04010   MAPK signaling pathway clum04137   Mitophagy - animal clum04140   Autophagy - animal clum04218   Cellular senescence clum04371   Apelin signaling pathway clum04625   C-type lectin receptor signaling pathway clum04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:clum00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     117734871 (rras)    04371 Apelin signaling pathway     117734871 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     117734871 (rras)    04137 Mitophagy - animal     117734871 (rras)   09143 Cell growth and death    04218 Cellular senescence     117734871 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     117734871 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     117734871 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clum04147]     117734871 (rras)    04031 GTP-binding proteins [BR:clum04031]     117734871 (rras) Exosome [BR:clum04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    117734871 (rras)   Exosomal proteins of bladder cancer cells    117734871 (rras) GTP-binding proteins [BR:clum04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     117734871 (rras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 ATP_bind_1 MMR_HSR1_Xtn Motif Other DBs NCBI-GeneID:  117734871 NCBI-ProteinID:  XP_034395079 Ensembl:  ENSCLMG00005020220 UniProt:  A0A8C3ANG7 LinkDB All DBs Position 8:10368429..10374730 Genome browser AA seq 197 aa AA seqDB search MSGEEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDIL DTAGQEEFGAMREQYMRAGEGFLLVFALNDRGSYHEVQKFHTQILRVKDRDDFPMVLVGN KADLDQQRVISRENAEAFARENRIHYMEASAKNRCNVDEVFLELVQIIRRFQEMESPPPP THHTRKQKRGGCPCVIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtggagaagaggaacgattcaaactggtggtggtgggaggaggaggggtggggaag agcgccctgaccatccagttcatccagtcctactttgtgtccgactacgaccccactatc gaagactcctacaccaagatctgcactgtggatggaaaggagacccggctggacatcttg gacaccgcaggtcaggaggagtttggagcgatgagggagcagtacatgcgcgcaggagaa ggcttcttgttggtatttgctctcaacgaccggggcagctaccatgaggtccagaaattc cacactcagatcctgagagtcaaggaccgagacgacttccccatggtgctggttggaaac aaggcggacctggaccagcaacgagtgatctccagggagaacgctgaggcgttcgccaga gagaaccggatccactacatggaggcttcagccaagaatcgctgcaacgtggatgaagtc ttcttggagctggtgcaaattatcagacggtttcaggagatggagagtcctcctcctcca actcatcacacaaggaaacagaaaaggggtggctgtccatgtgtcatcctctga

DBGET integrated database retrieval system