Cyclopterus lumpus (lumpfish): 117739540 Help Entry 117739540         CDS       T09199                                  Symbol s100a10a Name (RefSeq) protein S100-A10a isoform X1   KO K17274   protein S100-A10 Organism clum  Cyclopterus lumpus (lumpfish) Pathway clum04382   Cornified envelope formation clum05132   Salmonella infection Brite KEGG Orthology (KO) [BR:clum00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     117739540 (s100a10a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117739540 (s100a10a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clum04147]     117739540 (s100a10a) Exosome [BR:clum04147]  Exosomal proteins   Exosomal proteins of microglial cells    117739540 (s100a10a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 NNH2 DAXX_hist_bd EH SPARC_Ca_bdg Bcl-2 DUF826 Motif Other DBs NCBI-GeneID:  117739540 NCBI-ProteinID:  XP_034401894 Ensembl:  ENSCLMG00005016682 UniProt:  A0A8C3A298 LinkDB All DBs Position 11:complement(7038876..7040456) Genome browser AA seq 109 aa AA seqDB search MVFRHTSAAMPSELETAMESLIKVFHRYATNVGKERFALSRRQLKDLMENELSTFLQSQK DPAAVDKIMKDLDSNCDGHVDFEEFVSLVVGLSIACEHCYQNKMKMGKK NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atggtgttcagacacacctcagcagccatgccttcagaactagagaccgccatggagtca ctcatcaaggtgttccaccgctacgccaccaacgtcggcaaagaacgcttcgcactcagc cggcgacagctcaaagacttgatggagaacgagctgtcgaccttcctccagtcccagaag gaccctgctgctgtggacaaaatcatgaaggatctggacagcaactgtgacggccacgtt gactttgaggagtttgtttccctggttgttggactctcaattgcctgtgagcattgctat caaaacaaaatgaagatggggaagaagtaa

DBGET integrated database retrieval system