Cyclopterus lumpus (lumpfish): 117742565 Help Entry 117742565         CDS       T09199                                  Symbol dynll2b Name (RefSeq) dynein, light chain, LC8-type 2b   KO K10418   dynein light chain LC8-type Organism clum  Cyclopterus lumpus (lumpfish) Pathway clum04517   IgSF CAM signaling clum04814   Motor proteins clum05132   Salmonella infection Brite KEGG Orthology (KO) [BR:clum00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     117742565 (dynll2b)  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     117742565 (dynll2b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117742565 (dynll2b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:clum03037]     117742565 (dynll2b)    04812 Cytoskeleton proteins [BR:clum04812]     117742565 (dynll2b) Cilium and associated proteins [BR:clum03037]  Motile cilia and associated proteins   Dynein arm    117742565 (dynll2b) Cytoskeleton proteins [BR:clum04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      117742565 (dynll2b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light RP853 Nop Motif Other DBs NCBI-GeneID:  117742565 NCBI-ProteinID:  XP_034405956 Ensembl:  ENSCLMG00005009853 UniProt:  A0A8C2XJI3 LinkDB All DBs Position 14:complement(10749330..10751288) Genome browser AA seq 89 aa AA seqDB search MTEKKAVIKNADMSDEMQQDAVDCAMQAMEKYNIEKDIAAYVKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgagaagaaggcagtgataaagaatgcagacatgtctgatgaaatgcagcaggat gccgtggactgtgccatgcaggctatggaaaagtacaacattgaaaaggatatcgctgcc tatgtcaaaaaggagtttgacaagaagtacaaccccacatggcattgcattgttgggagg aactttggcagctacgtgacgcatgagacgaagcatttcatctacttctacctgggccaa gtggccattctactgttcaagtcgggctga

DBGET integrated database retrieval system