Cyclopterus lumpus (lumpfish): 117742832 Help Entry 117742832         CDS       T09199                                  Symbol ins Name (RefSeq) insulin   KO K04526   insulin Organism clum  Cyclopterus lumpus (lumpfish) Pathway clum04010   MAPK signaling pathway clum04068   FoxO signaling pathway clum04081   Hormone signaling clum04114   Oocyte meiosis clum04140   Autophagy - animal clum04150   mTOR signaling pathway clum04810   Regulation of actin cytoskeleton clum04910   Insulin signaling pathway clum04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:clum00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     117742832 (ins)    04068 FoxO signaling pathway     117742832 (ins)    04150 mTOR signaling pathway     117742832 (ins)   09133 Signaling molecules and interaction    04081 Hormone signaling     117742832 (ins)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     117742832 (ins)   09143 Cell growth and death    04114 Oocyte meiosis     117742832 (ins)   09142 Cell motility    04810 Regulation of actin cytoskeleton     117742832 (ins)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     117742832 (ins)    04914 Progesterone-mediated oocyte maturation     117742832 (ins)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:clum04052]     117742832 (ins) Cytokines and neuropeptides [BR:clum04052]  Neuropeptides   Unclassified    117742832 (ins) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  117742832 NCBI-ProteinID:  XP_034406367 LinkDB All DBs Position 14:complement(665101..665603) Genome browser AA seq 117 aa AA seqDB search MMAALWFQSVSLLVLLVLSCPGSQAASGPQHLCGSHLVDALYMVCGDRGFFYNPKRAVDP LMGFLPPKVGGALAAGGDNEVAEFAFKDQMEMMVKRGIVEQCCHRPCNFIDLQNYCN NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgatggcggccctgtggttccagtccgtgtctctgctggtcttactggttttgtcgtgt cctggttctcaggccgcctccggtcctcagcacctgtgtgggtctcacctggtggacgcc ctgtacatggtctgtggggaccggggcttcttctataaccccaagagggccgtggaccct ctgatgggtttcctccctcccaaagtgggcggagctttggcggcgggcggcgacaacgag gtggcggagttcgccttcaaggaccagatggagatgatggtgaagagaggcatcgtggag cagtgctgccaccggccgtgcaactttatcgacctgcagaactactgcaactga

DBGET integrated database retrieval system