Cyclopterus lumpus (lumpfish): 117745318 Help Entry 117745318         CDS       T09199                                  Symbol s100a10b Name (RefSeq) protein S100-A10b   KO K17274   protein S100-A10 Organism clum  Cyclopterus lumpus (lumpfish) Pathway clum04382   Cornified envelope formation clum05132   Salmonella infection Brite KEGG Orthology (KO) [BR:clum00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     117745318 (s100a10b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117745318 (s100a10b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clum04147]     117745318 (s100a10b) Exosome [BR:clum04147]  Exosomal proteins   Exosomal proteins of microglial cells    117745318 (s100a10b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 Motif Other DBs NCBI-GeneID:  117745318 NCBI-ProteinID:  XP_034409454 Ensembl:  ENSCLMG00005012769 UniProt:  A0A8C2ZEE4 LinkDB All DBs Position 16:10835729..10837332 Genome browser AA seq 99 aa AA seqDB search MTELENCMESLITIFHRYADEDGDGKTLSKKELSKLIETELPAFLKCQKNPKVVDDIRKD LDQNGDSKVDFEEFLSLVVGLSIACEKCFVLHEQKKGKK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgactgagttagagaactgcatggagtccctgatcaccatcttccatcgctatgccgat gaagacggcgatggaaagaccttgagcaagaaggaactgagcaaactaatagagaccgag ttgcccgccttcctgaaatgccagaagaaccccaaggttgtggacgacatccggaaggat ctggaccaaaacggagattcgaaggtggactttgaagagtttctttccctcgtcgtcggc ctctcaatagcctgtgagaagtgtttcgtgctccatgaacagaagaagggcaagaagtga

DBGET integrated database retrieval system