Cyclopterus lumpus (lumpfish): 117745495 Help Entry 117745495         CDS       T09199                                  Symbol cdc42l Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism clum  Cyclopterus lumpus (lumpfish) Pathway clum04010   MAPK signaling pathway clum04144   Endocytosis clum04370   VEGF signaling pathway clum04510   Focal adhesion clum04520   Adherens junction clum04530   Tight junction clum04810   Regulation of actin cytoskeleton clum04912   GnRH signaling pathway clum05100   Bacterial invasion of epithelial cells clum05132   Salmonella infection Brite KEGG Orthology (KO) [BR:clum00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     117745495 (cdc42l)    04370 VEGF signaling pathway     117745495 (cdc42l)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     117745495 (cdc42l)   09144 Cellular community - eukaryotes    04510 Focal adhesion     117745495 (cdc42l)    04520 Adherens junction     117745495 (cdc42l)    04530 Tight junction     117745495 (cdc42l)   09142 Cell motility    04810 Regulation of actin cytoskeleton     117745495 (cdc42l)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     117745495 (cdc42l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117745495 (cdc42l)    05100 Bacterial invasion of epithelial cells     117745495 (cdc42l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:clum04131]     117745495 (cdc42l)    03036 Chromosome and associated proteins [BR:clum03036]     117745495 (cdc42l)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clum04147]     117745495 (cdc42l)    04031 GTP-binding proteins [BR:clum04031]     117745495 (cdc42l) Membrane trafficking [BR:clum04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     117745495 (cdc42l)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     117745495 (cdc42l)   Macropinocytosis    Ras GTPases     117745495 (cdc42l) Chromosome and associated proteins [BR:clum03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     117745495 (cdc42l) Exosome [BR:clum04147]  Exosomal proteins   Exosomal proteins of microglial cells    117745495 (cdc42l)   Exosomal proteins of breast milk    117745495 (cdc42l) GTP-binding proteins [BR:clum04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     117745495 (cdc42l) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  117745495 NCBI-ProteinID:  XP_034409768 Ensembl:  ENSCLMG00005006422 UniProt:  A0A8C2Z118 LinkDB All DBs Position 16:complement(12456115..12460261) Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEISHHCPRTPFLLVGTQVDLR EDSNTIEKLAKNKQRPLYIESGEKLARELKAVKYVECSALTQRGLKNVFDEAILAALEPP EMKNKKRCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagactataaaatgtgtagtggtaggtgacggtgcagtcggaaagacctgcttactg atctcctacacaaccaacaagttcccttcagaatatgtgccgacggtttttgacaattat gcagtgacggtgatgattgggggggagccctatacactcggcctatttgacacagcaggt caggaggattatgaccggctgcgtcccctcagctatccacagacagatgtgttccttgtt tgcttctccgtcgtctccccatcatcttttgaaaatgtcaaagaaaagtgggttcctgag atttctcaccactgcccacgcacacccttcctgttagtgggcactcaggtggatcttcgg gaagacagcaacacgatcgagaagctggcgaagaacaaacagcgccccctatatattgag agcggagagaagcttgctcgtgagctgaaggctgtcaaatacgtggagtgctctgctctg acacagcgaggacttaagaatgtgtttgacgaggccatcctggcagcactggagcctcct gagatgaaaaacaaaaagaggtgtgtcctgctatag

DBGET integrated database retrieval system