Cyclopterus lumpus (lumpfish): 117745513 Help Entry 117745513         CDS       T09199                                  Symbol atg12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism clum  Cyclopterus lumpus (lumpfish) Pathway clum04068   FoxO signaling pathway clum04136   Autophagy - other clum04140   Autophagy - animal clum04621   NOD-like receptor signaling pathway clum04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:clum00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     117745513 (atg12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     117745513 (atg12)    04136 Autophagy - other     117745513 (atg12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     117745513 (atg12)    04622 RIG-I-like receptor signaling pathway     117745513 (atg12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:clum04131]     117745513 (atg12)    04121 Ubiquitin system [BR:clum04121]     117745513 (atg12)    03029 Mitochondrial biogenesis [BR:clum03029]     117745513 (atg12) Membrane trafficking [BR:clum04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     117745513 (atg12) Ubiquitin system [BR:clum04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    117745513 (atg12) Mitochondrial biogenesis [BR:clum03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     117745513 (atg12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  117745513 NCBI-ProteinID:  XP_034409796 Ensembl:  ENSCLMG00005021145 UniProt:  A0A8C3AS51 LinkDB All DBs Position 16:complement(11929117..11931946) Genome browser AA seq 119 aa AA seqDB search MKMSDNAESPIETQKEESQPPSDESTTTDDKKKIDVLLKAVGNTPIMKTKKWAVERGRTI QSLSQFISRFLKLDGSEQLFIYVNQSFAPSPDQDVGVLFDCFGSDGKLILHYCKSQAWG NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgaagatgtctgacaacgcagagtccccaatagaaacgcaaaaagaggagtcacaaccg ccttcggacgagtcgacgacaactgatgataagaaaaaaattgatgtgctgctgaaggca gtaggaaacactcctataatgaaaacaaagaagtgggccgtggaaagggggaggacgata cagtccctgtctcagttcatctctcgtttcctcaagcttgatggcagtgaacaattgttc atttatgttaaccagtcatttgccccctcaccggatcaagacgtaggggtcctttttgat tgttttggcagtgatggaaagctcattctgcattactgtaaatctcaagcctggggttaa

DBGET integrated database retrieval system