Cyclopterus lumpus (lumpfish): 117749041 Help Entry 117749041         CDS       T09199                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism clum  Cyclopterus lumpus (lumpfish) Pathway clum04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:clum00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     117749041  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:clum04121]     117749041    03400 DNA repair and recombination proteins [BR:clum03400]     117749041 Ubiquitin system [BR:clum04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      117749041    Cul5 complex      117749041 DNA repair and recombination proteins [BR:clum03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      117749041 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD LED_rpt Motif Other DBs NCBI-GeneID:  117749041 NCBI-ProteinID:  XP_034415134 Ensembl:  ENSCLMG00005003894 LinkDB All DBs Position 19:complement(9610264..9614120) Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRPPEDQRLYKDDQSLEDTKTLGDC GFTNQTARPQAPATVGLAFRINDEMFEQLHIEAFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcttaatgatccggcgtcacaagactacaatctttacagatgccaaggag tctaccactgtctatgagctgaagcgtattgttgaaggaattcttaagagaccacctgaa gaccagaggctgtacaaagatgaccagtcgctagaggacaccaaaactcttggagactgt ggattcaccaaccagactgccagacctcaagctccagctacagttggtctggccttccgc ataaatgatgagatgtttgaacagctccacatcgaggccttctccagccccccagaactc cctgatgtgatgaagcctcaggactccggtagcactgccaacgaacaggctgtgcagtga

DBGET integrated database retrieval system