KEGG   Clavispora lusitaniae CBS 6936: A9F13_24g00099
Entry
A9F13_24g00099    CDS       T05147                                 
Name
(GenBank) putative DNA damage checkpoint protein
  KO
K06663  DNA damage checkpoint protein
Organism
clus  Clavispora lusitaniae CBS 6936
Pathway
clus04111  Cell cycle - yeast
clus04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:clus00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    A9F13_24g00099
   04113 Meiosis - yeast
    A9F13_24g00099
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:clus03400]
    A9F13_24g00099
DNA repair and recombination proteins [BR:clus03400]
 Eukaryotic type
  Check point factors
   Rad17-Mec3-Ddc1 complex
    A9F13_24g00099
SSDB
Motif
Pfam: Rad9
Other DBs
NCBI-ProteinID: OVF05116
LinkDB
AA seq 338 aa
MLTLFKNLEPSNLSYIFLRVDCNESTPIARRNKLLVEILTKKLIVKKYQMNYSPVEHMGT
AIGTSYKTEFEEGNVNFFMMETAIMKSFFDMVPLATEDLSIDVKTTKISFGAYTKQVLKD
REYLKQPMSITISMAVNELMDSNLGDVSLSVNFRLKDFRTFIALCTSLKTDGRCEPQYFD
GDPHFEAYFKKNGDPIFFEFKSQNAVVRFIQFTADENATVDESKEKYVLVAPTISRAGTS
LTEMTESVANSRQSQIISLSPSRASRFSSYRPESDDFPSTHHAHRHIVTYGKAPSDSPDR
QPTARNSDTDYNTSDENEGEQQTLGPTQTTNKPVSLFE
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgttgacgttgtttaagaatctcgagcctagtaacttgagctacatcttcctacgcgtc
gattgcaacgaaagtacacctatcgcacgtcgaaataaactactagtcgaaattttgact
aagaaattaattgtcaagaaatatcagatgaattacctgcctgttgaacacatgggcacg
gcaattggtactagctataagacagaattcgaggaagggaatgtcaattttttcatgatg
gaaacggcaatcatgaaactgttttttgatatggttcctctcgcaacagaggatctttcg
atagatgtgaagactactaagatactgtttggcgcatatacaaaacaagttctaaaagac
cgtgagtacctcaaacaacccatgctgattacaatcctgatggcagtgaatgagctaatg
gattcgaatttgggcgatgtaagtctctctgtcaattttcgactcaaagatttccgaact
tttattgcgctttgtacgtcactcaaaacagatggtcgctgtgaaccacaatacttcgac
ggtgatccgcattttgaggcatatttcaagaagaacggagatcccatttttttcgaattc
aagtctcagaatgctgttgtcaggtttatccagtttactgctgatgaaaacgctacggtg
gatgagtcgaaagagaagtatgtgctcgtagcaccaaccatcctgagggcaggaacttca
ctaactgaaatgacagaatccgtcgcaaattcacgccagtcacaaataataagtttatca
ccatctcgtgccctgcgattttcttcctatcggcccgaatctgacgattttccgtccaca
catcatgctcatagacatatagtgacctacggcaaggcaccatcggactcgccagacaga
caaccaacagccagaaatagtgatacagactacaatacgtcggatgaaaatgagggtgaa
cagcagacattaggacctactcagaccacaaacaaaccagtttcactttttgagtga

DBGET integrated database retrieval system