Columba livia (rock pigeon): 102085987 Help Entry 102085987         CDS       T02912                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism clv  Columba livia (rock pigeon) Pathway clv04137   Mitophagy - animal clv04140   Autophagy - animal clv04144   Endocytosis clv04145   Phagosome clv04148   Efferocytosis clv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:clv00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102085987 (RAB7A)    04145 Phagosome     102085987 (RAB7A)    04140 Autophagy - animal     102085987 (RAB7A)    04137 Mitophagy - animal     102085987 (RAB7A)    04148 Efferocytosis     102085987 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102085987 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:clv04131]     102085987 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clv04147]     102085987 (RAB7A)    04031 GTP-binding proteins [BR:clv04031]     102085987 (RAB7A) Membrane trafficking [BR:clv04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     102085987 (RAB7A) Exosome [BR:clv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102085987 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    102085987 (RAB7A)   Exosomal proteins of colorectal cancer cells    102085987 (RAB7A)   Exosomal proteins of bladder cancer cells    102085987 (RAB7A) GTP-binding proteins [BR:clv04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     102085987 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_24 AAA_16 G-alpha AAA_5 ATPase_2 AAA_14 NACHT NB-ARC ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  102085987 NCBI-ProteinID:  XP_005507576 UniProt:  A0A2I0LVQ3 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRVKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacttctaggaagaaagtgttactgaaagtcatcatccttggagactctggggtggga aagacatcgcttatgaaccagtatgtgaacaagaaattcagtaaccagtacaaggctacg ataggcgcagacttcctgacaaaagaggtgatggtggatgacaggctagtgacaatgcag atatgggatacagcaggacaagaacgatttcagtctctgggagttgccttctacagggga gcagactgctgcgtgctggtgtttgatgtcacggcccccaacacattcaaaactctagac agctggagggacgaattcctcattcaggccagtccaagggatcctgagaactttcctttt gttgtgctgggaaacaagattgacctagaaaacagacaagtcaccacaaaacgggcacaa gcctggtgctacagtaaaaacaacatcccctactttgaaaccagtgccaaggaggccatt aatgtggaacaagctttccagacgattgcacgaaatgcacttaaacaggaaactgaagtg gagctttacaatgaattccccgaacccatcaaactagacaagaatgaccgagtgaaggct tctgcggagagctgcagctgctga

DBGET integrated database retrieval system