Columba livia (rock pigeon): 102086675 Help Entry 102086675         CDS       T02912                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism clv  Columba livia (rock pigeon) Pathway clv04081   Hormone signaling clv04144   Endocytosis clv04150   mTOR signaling pathway clv04270   Vascular smooth muscle contraction clv04310   Wnt signaling pathway clv04350   TGF-beta signaling pathway clv04510   Focal adhesion clv04517   IgSF CAM signaling clv04519   Cadherin signaling clv04520   Adherens junction clv04530   Tight junction clv04621   NOD-like receptor signaling pathway clv04625   C-type lectin receptor signaling pathway clv04810   Regulation of actin cytoskeleton clv05100   Bacterial invasion of epithelial cells clv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:clv00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     102086675 (RHOA)    04350 TGF-beta signaling pathway     102086675 (RHOA)    04150 mTOR signaling pathway     102086675 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     102086675 (RHOA)    04517 IgSF CAM signaling     102086675 (RHOA)    04519 Cadherin signaling     102086675 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102086675 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102086675 (RHOA)    04520 Adherens junction     102086675 (RHOA)    04530 Tight junction     102086675 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102086675 (RHOA)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102086675 (RHOA)    04625 C-type lectin receptor signaling pathway     102086675 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     102086675 (RHOA)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102086675 (RHOA)    05100 Bacterial invasion of epithelial cells     102086675 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:clv04131]     102086675 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clv04147]     102086675 (RHOA)    04031 GTP-binding proteins [BR:clv04031]     102086675 (RHOA) Membrane trafficking [BR:clv04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     102086675 (RHOA) Exosome [BR:clv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102086675 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    102086675 (RHOA)   Exosomal proteins of colorectal cancer cells    102086675 (RHOA)   Exosomal proteins of bladder cancer cells    102086675 (RHOA) GTP-binding proteins [BR:clv04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     102086675 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  102086675 NCBI-ProteinID:  XP_005508923 UniProt:  A0A2I0LWA3 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccattcgaaaaaagctggttatagtgggtgatggtgcctgtggaaagacctgt ctgctgattgtatttagcaaagaccagttccctgaagtgtatgttcccaccgtctttgaa aattatgtagcagatattgaagtggatggaaagcaggttgagttggctttgtgggataca gcaggacaagaagactacgatcgacttagaccgctttcttatccagataccgatgttata cttatgtgtttttcaattgatagccctgatagtttagaaaacatcccagagaagtggacc ccggaggtgaagcatttctgccccaatgtgcctatcatcttggtaggaaacaagaaggac ctgaggaatgacgagcacacaagacgagagctggccaaaatgaagcaggagcctgtcaaa cccgaagaaggaagagatatggcaaaccgcattggtgcatttgggtatatggagtgttcg gcaaagaccaaagacggtgtgagggaggtttttgaaatggccactagagctgctttgcaa gcccggcgtggcaagaaaaagtccgggtgccttctcttataa

DBGET integrated database retrieval system