Columba livia (rock pigeon): 102087205 Help Entry 102087205         CDS       T02912                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism clv  Columba livia (rock pigeon) Pathway clv04810   Regulation of actin cytoskeleton clv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:clv00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102087205 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102087205 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:clv04131]     102087205 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:clv04812]     102087205 (PFN3)    04147 Exosome [BR:clv04147]     102087205 (PFN3) Membrane trafficking [BR:clv04131]  Others   Actin-binding proteins    Others     102087205 (PFN3) Cytoskeleton proteins [BR:clv04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102087205 (PFN3) Exosome [BR:clv04147]  Exosomal proteins   Proteins found in most exosomes    102087205 (PFN3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Terminase-T7_RNaseH-like Motif Other DBs NCBI-GeneID:  102087205 NCBI-ProteinID:  XP_005500042 UniProt:  A0A2I0M503 LinkDB All DBs Position Unknown AA seq 134 aa AA seqDB search MDYWNYYVNSILADRNVEDVAIVGLFDNKCVWAAKPGGILAAISPQEVGLITGQDRKTLL LTGITVAGKKCSVIRDNLLVDEDNVMDVRSKGSDSRSICIGKTIQALIFLMGKKGVHGGA LNQKVHDIIVGMKV NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atggattactggaattactacgtcaacagcatcctggcagacaggaacgtagaagatgtg gctattgtgggcctcttcgacaacaaatgcgtgtgggctgccaagccgggagggattctt gcagccatctcgcctcaagaagtgggcttgatcacaggccaggatcggaaaacactcctg ctaacgggaatcaccgtagctggcaaaaagtgcagtgtgattcgtgacaacctgctcgtg gatgaagacaatgtgatggatgtcagaagcaagggcagtgacagcagatccatctgtatt ggcaagaccatccaagccctgatcttcctcatgggcaagaagggagtccatggaggagcc ctcaaccaaaaggtccacgatatcattgtgggcatgaaagtatga

DBGET integrated database retrieval system