Columba livia (rock pigeon): 102088359 Help Entry 102088359         CDS       T02912                                  Name (RefSeq) histone H2A-IV   KO K11251   histone H2A Organism clv  Columba livia (rock pigeon) Pathway clv03082   ATP-dependent chromatin remodeling clv04217   Necroptosis Brite KEGG Orthology (KO) [BR:clv00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     102088359  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102088359  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:clv03036]     102088359   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clv04147]     102088359 Chromosome and associated proteins [BR:clv03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102088359 Exosome [BR:clv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102088359 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  102088359 NCBI-ProteinID:  XP_005515829 UniProt:  R7VRD6 LinkDB All DBs Position Unknown AA seq 127 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVMEYLT AEILELAXXXXXXXXXXIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTE SHKVKAK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgtcaggccgggggaagcagggggggaaagcccgcgctaaggcgaagtcccgatcatcc cgcgccggcctccagttccccgtgggccgcgttcaccgccttctccgcaaaggcaactac gcggagcgagtgggtgcgggagcccccgtctacctggccgctgttatggagtatttaacg gctgagatcttggagctggccnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnatcccccgg catctccagctcgccgttcgtaacgacgaggagctcaacaagctgctgggcggcgtcacc atcgcgcaagggggggtcctgcctaatatccaggcggtgctgttgcccaagaagaccgag agccacaaggtcaaggccaagtga

DBGET integrated database retrieval system