Columba livia (rock pigeon): 102091763 Help Entry 102091763         CDS       T02912                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism clv  Columba livia (rock pigeon) Pathway clv04010   MAPK signaling pathway clv04012   ErbB signaling pathway clv04068   FoxO signaling pathway clv04137   Mitophagy - animal clv04140   Autophagy - animal clv04144   Endocytosis clv04150   mTOR signaling pathway clv04210   Apoptosis clv04218   Cellular senescence clv04370   VEGF signaling pathway clv04371   Apelin signaling pathway clv04510   Focal adhesion clv04540   Gap junction clv04625   C-type lectin receptor signaling pathway clv04810   Regulation of actin cytoskeleton clv04910   Insulin signaling pathway clv04912   GnRH signaling pathway clv04916   Melanogenesis clv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:clv00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     102091763 (HRAS)    04150 mTOR signaling pathway     102091763 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102091763 (HRAS)    04140 Autophagy - animal     102091763 (HRAS)    04137 Mitophagy - animal     102091763 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:clv04131]     102091763 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clv04147]     102091763 (HRAS)    04031 GTP-binding proteins [BR:clv04031]     102091763 (HRAS) Membrane trafficking [BR:clv04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     102091763 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     102091763 (HRAS) Exosome [BR:clv04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    102091763 (HRAS)   Exosomal proteins of colorectal cancer cells    102091763 (HRAS) GTP-binding proteins [BR:clv04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102091763 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  102091763 NCBI-ProteinID:  XP_005509117 UniProt:  A0A2I0MI00 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLSRSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatataaactggtggtggtcggagctggtggtgttgggaagagtgctttgaca atacagctcattcagaaccatttcgttgatgaatatgaccccacgatagaggattcctac agaaagcaggttgtcattgatggagagacctgcttgttagacatcttggatactgcaggg caagaggagtacagtgccatgagagaccagtacatgagaaccggggaaggattcctctgt gtcttcgccatcaacaacacaaagtcctttgaagatattcaccagtacagggagcaaatc aagagggtgaaagactcagatgatgttcctatggtactggtggggaataaatgtgaccta ccagcccggacagtggagacccggcaagcgcaggacctgtcccgaagttacgggatcccc tacatagaaacatctgccaaaaccagacagggcgttgaagatgccttctataccttggtg cgggagatccgtcagcacaagctgcgcaagctgaatcccccagatgagagcggccccggc tgcatgaactgtaaatgtgtgatatcgtga

DBGET integrated database retrieval system