Columba livia (rock pigeon): 102091774 Help Entry 102091774         CDS       T02912                                  Symbol CUNH9orf142 Name (RefSeq) protein PAXX   KO K25772   protein PAXX Organism clv  Columba livia (rock pigeon) Brite KEGG Orthology (KO) [BR:clv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:clv03400]     102091774 (CUNH9orf142) DNA repair and recombination proteins [BR:clv03400]  Eukaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     Other NHEJ factors      102091774 (CUNH9orf142) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PAXX Motif Other DBs NCBI-GeneID:  102091774 NCBI-ProteinID:  XP_005513726 LinkDB All DBs Position Unknown AA seq 82 aa AA seqDB search MAGHVQSLERRLEAVVETAVSSCSPEKSAARSQQLFLPDPSPRKNRGAVSALPAKRKIPG ESLINPGFKSKKAPSGVDFEDS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcggggcacgtccagagcctggagcgacgcctggaagcagtggtggagacagcggta tcttcctgcagccctgagaagagcgctgcccgcagccagcagctcttcctaccagacccc agcccaaggaagaacaggggtgctgtctcggctttgccggccaagaggaagatcccgggg gagtctctaattaaccctggtttcaaaagcaagaaggctccgtctggagtggacttcgag gactcctga

DBGET integrated database retrieval system