Columba livia (rock pigeon): 110358055 Help Entry 110358055         CDS       T02912                                  Symbol IL17D Name (RefSeq) interleukin-17D   KO K05492   interleukin 17D Organism clv  Columba livia (rock pigeon) Pathway clv04060   Cytokine-cytokine receptor interaction clv04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:clv00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110358055 (IL17D)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     110358055 (IL17D)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:clv04052]     110358055 (IL17D) Cytokines and neuropeptides [BR:clv04052]  Cytokines   Interleukins    110358055 (IL17D) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL17 FAM221 Motif Other DBs NCBI-GeneID:  110358055 NCBI-ProteinID:  XP_021141926 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MHLYYLLSCRISYDPTRYPKYIPEAYCLCKGCLMGIFGEENFHFRSTPVYMPAVILRRTS SCAGGRYVYTEDYVTIPVGCTCVPEQEKEAESVNSSIDKQEMKLLA NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgcatctttattatttactttcctgtagaatttcatatgatcccacaagatacccgaag tacattcctgaagcatactgcctgtgcaaaggctgcctcatggggatctttggcgaggag aacttccacttccgcagcaccccggtgtacatgcccgccgtcatcctgcgccgcacctcc tcctgcgctggcggccgctacgtctacacggaagattatgtcactatcccagtgggctgc acttgtgtgcccgagcaagaaaaagaggcagaaagcgtaaattccagcatagataagcaa gaaatgaagttgctggcatga

DBGET integrated database retrieval system