Columba livia (rock pigeon): 110364409 Help Entry 110364409         CDS       T02912                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism clv  Columba livia (rock pigeon) Pathway clv04810   Regulation of actin cytoskeleton clv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:clv00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     110364409 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110364409 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:clv04131]     110364409 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:clv04812]     110364409 (PFN4)    04147 Exosome [BR:clv04147]     110364409 (PFN4) Membrane trafficking [BR:clv04131]  Others   Actin-binding proteins    Others     110364409 (PFN4) Cytoskeleton proteins [BR:clv04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      110364409 (PFN4) Exosome [BR:clv04147]  Exosomal proteins   Proteins found in most exosomes    110364409 (PFN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  110364409 NCBI-ProteinID:  XP_021153641 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search AIIDIKQQKVCASTSGFNVPPDDALNLIYAFHQNLLQVRRGGLFFKEKRYKCVRADKHSI YLQNPDRGLIVVKTKTFILVATYKGDMYPSVCVEAVEKLADFFREEGR NT seq 327 nt NT seq  +upstreamnt  +downstreamnt gctatcattgacataaagcaacaaaaagtctgtgcatcaacctctggctttaatgtgcca ccagacgatgctttaaaccttatctacgctttccatcagaacttactgcaagttagaagg ggaggactcttcttcaaggagaagcgctataaatgtgtccgtgcagataaacattccatt tatcttcaaaatccagatagaggactgatagttgtgaagacaaagactttcatcctggtt gctacttacaaaggggacatgtatcccagtgtctgtgtggaagctgtggagaaactggcg gacttctttagagaggaaggtcgctga

DBGET integrated database retrieval system