Columba livia (rock pigeon): 8890003 Help Entry 8890003           CDS       T02912                                  Symbol ND3 Name (RefSeq) NADH dehydrogenase subunit 3   KO K03880   NADH-ubiquinone oxidoreductase chain 3 [EC:7.1.1.2] Organism clv  Columba livia (rock pigeon) Pathway clv00190   Oxidative phosphorylation clv01100   Metabolic pathways Module clv_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:clv00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     8890003 (ND3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:clv03029]     8890003 (ND3) Enzymes [BR:clv01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      8890003 (ND3) Mitochondrial biogenesis [BR:clv03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     8890003 (ND3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q4 Bac_export_2 Motif Other DBs NCBI-GeneID:  8890003 NCBI-ProteinID:  YP_003540715 UniProt:  D4PBQ5 LinkDB All DBs Position MT AA seq 116 aa AA seqDB search MNMITFMLTLSLILSILLTTLNFWLAQMNPDLEKLSPYECGFDPLGSARLPFSIRFFLVA ILFLLFDLEIALLLPLPWASQLQSPVTTLTWASTLILLLTLGLIYEWVQGGLEWAE NT seq 351 nt NT seq  +upstreamnt  +downstreamnt attaacataatcacattcatactcaccttatcccttatcctatccatcctcttaaccaca ttaaacttttgacttgcccaaataaacccagacctagaaaaactatccccgtacgaatgc ggcttcgaccccttgggatccgctcgactcccattttcaatccgattcttcctagtagcc atcctcttcctcctcttcgacctagaaattgccctcctcctgcccctcccatgagccagc caacttcaatcccctgtcaccacactaacttgagcctccacccttattctcctactaaca ctaggactaatctatgaatgggtgcaaggaggactagaatgagcagaataa

DBGET integrated database retrieval system