Campylobacter lanienae: CLAN_1483 Help Entry CLAN_1483         CDS       T05075                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism clx  Campylobacter lanienae Pathway clx01100   Metabolic pathways clx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:clx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CLAN_1483    00074 Mycolic acid biosynthesis     CLAN_1483   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CLAN_1483 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF2682 Motif Other DBs NCBI-ProteinID:  ARQ98198 UniProt:  A0A1X9SPS4 LinkDB All DBs Position complement(1451211..1451459) Genome browser AA seq 82 aa AA seqDB search MIDEVKEFIIESLNLSDIRPNDIDENAPLFNDGLGLDSVDALELGLAITKRYGIVLDSKS KNLEEIFANVSNLAKFIKENRK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgatagatgaggttaaggaatttataattgaaagcttgaatctttcagatattaggcct aatgatatagatgagaatgcgccactttttaatgatggattagggcttgatagcgttgat gccttagagcttggacttgctattacaaagcgttatggcatagttcttgatagcaaaagc aagaatttagaagagatatttgctaatgttagtaatttagcgaagtttatcaaggagaat agaaaatga

DBGET integrated database retrieval system