Chlorobaculum limnaeum: BIU88_11200 Help Entry BIU88_11200       CDS       T04492                                  Name (GenBank) ATP synthase F1 subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism clz  Chlorobaculum limnaeum Pathway clz00190   Oxidative phosphorylation clz01100   Metabolic pathways Module clz_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:clz00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BIU88_11200  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:clz00194]     BIU88_11200 Photosynthesis proteins [BR:clz00194]  Photosystem and electron transport system   F-type ATPase [OT]    BIU88_11200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  AOS84648 UniProt:  A0A1D8D8T7 LinkDB All DBs Position 2481954..2482220 Genome browser AA seq 88 aa AA seqDB search MASSDKAFKLDIVTPQKLFFSGEVTSVIAPGLDGLFQVMKGHAPLLAALKSGKVRLSLAD RSENSFQIEGGFFEVSSNKAILLTEEVA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggcaagttcagacaaagccttcaagctcgatatcgtcacgccgcagaagcttttcttt tcgggagaggtgaccagcgtcatcgctccgggcctggacgggttgtttcaggttatgaaa ggtcacgctcccctgctcgccgcgctcaaaagcggcaaggtgcggctctctcttgctgac cgctccgagaactcgttccagatcgagggcggattcttcgaggtgagcagcaacaaggcg attctgctgaccgaagaggtcgcctga

DBGET integrated database retrieval system