Croceicoccus marinus: A9D14_03525 Help Entry A9D14_03525       CDS       T04890                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cman  Croceicoccus marinus Pathway cman01100   Metabolic pathways cman01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cman00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A9D14_03525    00074 Mycolic acid biosynthesis     A9D14_03525   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A9D14_03525 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ARU17216 UniProt:  A0A1Z1FEQ5 LinkDB All DBs Position 737222..737452 Genome browser AA seq 76 aa AA seqDB search MSDEEIMAMVAQESGLPRARLDMDARLGTLDISSIDMVSLLFEVEDRYGVEIEPEQVTPE MTLGELVNRIREKAKA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgaggagataatggcgatggtcgcgcaggaaagcggcctgccccgcgcaagg ctggacatggacgcgcgactgggcacgctcgacatatcctcgatcgacatggtcagcctg ctgttcgaggtcgaggaccgctatggcgtcgagatcgagcccgagcaggtcacgcccgag atgacgctgggcgagctggtgaaccgcatccgcgaaaaggcgaaagcttga

DBGET integrated database retrieval system