Colossoma macropomum (tambaqui): 118799410 Help Entry 118799410         CDS       T09004                                  Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism cmao  Colossoma macropomum (tambaqui) Pathway cmao04081   Hormone signaling cmao04144   Endocytosis cmao04150   mTOR signaling pathway cmao04270   Vascular smooth muscle contraction cmao04310   Wnt signaling pathway cmao04350   TGF-beta signaling pathway cmao04510   Focal adhesion cmao04517   IgSF CAM signaling cmao04520   Adherens junction cmao04530   Tight junction cmao04621   NOD-like receptor signaling pathway cmao04625   C-type lectin receptor signaling pathway cmao04810   Regulation of actin cytoskeleton cmao05100   Bacterial invasion of epithelial cells cmao05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cmao00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     118799410    04350 TGF-beta signaling pathway     118799410    04150 mTOR signaling pathway     118799410   09133 Signaling molecules and interaction    04081 Hormone signaling     118799410    04517 IgSF CAM signaling     118799410  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     118799410   09144 Cellular community - eukaryotes    04510 Focal adhesion     118799410    04520 Adherens junction     118799410    04530 Tight junction     118799410   09142 Cell motility    04810 Regulation of actin cytoskeleton     118799410  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     118799410    04625 C-type lectin receptor signaling pathway     118799410   09153 Circulatory system    04270 Vascular smooth muscle contraction     118799410  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118799410    05100 Bacterial invasion of epithelial cells     118799410  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmao04131]     118799410   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cmao04147]     118799410    04031 GTP-binding proteins [BR:cmao04031]     118799410 Membrane trafficking [BR:cmao04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     118799410 Exosome [BR:cmao04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118799410   Exosomal proteins of other body fluids (saliva and urine)    118799410   Exosomal proteins of colorectal cancer cells    118799410   Exosomal proteins of bladder cancer cells    118799410 GTP-binding proteins [BR:cmao04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     118799410 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  118799410 NCBI-ProteinID:  XP_036415148 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIYAFGYMECSAKTKDGVREVFEMATRAALQ ARKGKKGTKCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagcaatccgtaagaagctggtgatagtcggagatggggcttgcggaaagacctgt ctcctcatcgtcttcagcaaagaccagttccccgaggtctatgtgcctacagtgtttgaa aactacgtggccgacattgaagtggatggaaaacaggttgagctggccctgtgggataca gccggccaggaggactatgataggcttcgtccgctctcctacccagacactgacgtcatc ctgatgtgcttctcgatcgacagccccgacagtcttgagaacattccagaaaaatggact cctgaggtgaaacacttctgccccaacgtccccatcatcctggtgggcaacaagaaggac ctgcgtaacgacgagcacacccggcgtgagctggctaagatgaagcaggagcccgtcaaa ccagaagagggcagagacatggccaaccggatctacgcctttggatacatggagtgctcc gccaagacgaaggacggagtgagggaggtgtttgaaatggccaccagggcggcgctgcag gccagaaagggcaagaagggcactaaatgcctcctactgtaa

DBGET integrated database retrieval system