Colossoma macropomum (tambaqui): 118802699 Help Entry 118802699         CDS       T09004                                  Symbol dynlt3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism cmao  Colossoma macropomum (tambaqui) Pathway cmao04145   Phagocytosis cmao04814   Motor proteins cmao05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cmao00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     118802699 (dynlt3)   09142 Cell motility    04814 Motor proteins     118802699 (dynlt3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118802699 (dynlt3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cmao03037]     118802699 (dynlt3)    04812 Cytoskeleton proteins [BR:cmao04812]     118802699 (dynlt3) Cilium and associated proteins [BR:cmao03037]  Motile cilia and associated proteins   Dynein arm    118802699 (dynlt3) Cytoskeleton proteins [BR:cmao04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      118802699 (dynlt3) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  118802699 NCBI-ProteinID:  XP_036419041 LinkDB All DBs Position Unknown AA seq 115 aa AA seqDB search MEEYHSGDEVAFNPDEASNAVKECIEGVIGGVDYNQNKVNQWTASIVEHSLTQLVKQGKP FKYIVNCAVMQKSGAGLHTANSCYWDTTTDGSCTVRWENRTMYCVVSVFAVAVTL NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggaggagtaccattccggagatgaggtggccttcaatcctgatgaagcaagtaacgct gttaaagagtgcattgagggtgttattggaggcgtggactacaaccagaataaagtgaac cagtggacggccagcatagtcgagcactcgctcactcagctggttaaacagggaaagcca ttcaagtacattgttaactgtgctgtgatgcagaaaagtggggcaggacttcacactgcc aactcctgttactgggacacaaccactgatggaagctgcacagtcagatgggagaaccgc accatgtactgcgttgtaagtgtgtttgccgtcgctgtcactctctga

DBGET integrated database retrieval system