Colossoma macropomum (tambaqui): 118806420 Help Entry 118806420         CDS       T09004                                  Symbol insb Name (RefSeq) preproinsulin b   KO K04526   insulin Organism cmao  Colossoma macropomum (tambaqui) Pathway cmao04010   MAPK signaling pathway cmao04068   FoxO signaling pathway cmao04081   Hormone signaling cmao04114   Oocyte meiosis cmao04140   Autophagy - animal cmao04150   mTOR signaling pathway cmao04810   Regulation of actin cytoskeleton cmao04910   Insulin signaling pathway cmao04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:cmao00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118806420 (insb)    04068 FoxO signaling pathway     118806420 (insb)    04150 mTOR signaling pathway     118806420 (insb)   09133 Signaling molecules and interaction    04081 Hormone signaling     118806420 (insb)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118806420 (insb)   09143 Cell growth and death    04114 Oocyte meiosis     118806420 (insb)   09142 Cell motility    04810 Regulation of actin cytoskeleton     118806420 (insb)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     118806420 (insb)    04914 Progesterone-mediated oocyte maturation     118806420 (insb)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cmao04052]     118806420 (insb) Cytokines and neuropeptides [BR:cmao04052]  Neuropeptides   Unclassified    118806420 (insb) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  118806420 NCBI-ProteinID:  XP_036423732 LinkDB All DBs Position Unknown AA seq 112 aa AA seqDB search MLPAMALMLQAAPMFLLLVSSPGIHSSPSQHLCGSSLVDALYVVCGARGFFYAHRGERDL EALLAVLSKTSGHENMVEGIPTKKLELKVKRGIVDQCCHRPCTLSHLQNYCN NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atgctgcctgcaatggccctgatgctgcaggcagcccctatgttcctcctgctggtctct tctccaggtatccattcctctccatctcagcacctgtgtggctccagcctggtggatgct ctctatgtcgtttgtggtgcaagaggcttcttttatgcccacagaggggagagggacctt gaggcgttgctggctgtcctctcaaagacttctggtcatgagaacatggtggagggcatc cctacgaagaagctggaactaaaagtgaagagagggattgtggaccagtgctgccacagg ccctgcaccttatcccacctgcaaaactactgtaactga

DBGET integrated database retrieval system