Colossoma macropomum (tambaqui): 118807514 Help Entry 118807514         CDS       T09004                                  Symbol smx5 Name (RefSeq) smx5   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism cmao  Colossoma macropomum (tambaqui) Pathway cmao03018   RNA degradation cmao03040   Spliceosome Brite KEGG Orthology (KO) [BR:cmao00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     118807514 (smx5)   09123 Folding, sorting and degradation    03018 RNA degradation     118807514 (smx5)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cmao03019]     118807514 (smx5)    03041 Spliceosome [BR:cmao03041]     118807514 (smx5) Messenger RNA biogenesis [BR:cmao03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      118807514 (smx5)   mRNA degradation factors    5'-3' decay     Lsm complex      118807514 (smx5) Spliceosome [BR:cmao03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     118807514 (smx5)  Complex C   U2 snRNP components     118807514 (smx5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM SM-ATX DYW_deaminase Motif Other DBs NCBI-GeneID:  118807514 NCBI-ProteinID:  XP_036425426 LinkDB All DBs Position Unknown AA seq 95 aa AA seqDB search MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNC FIRGSVVRYVQLPADEVDTQLLQDAARKEAMQQKQ NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgcttttctactcattcttcaagtccctggtgggcaaagacgtggtggtggaattaaaa aatgacttgagcatatgtggaacactacattctgtcgatcagtatctgaacatcaaactc acagacatcagtgtcactgaccctgagaagtatccccacatgttgtcggtgaaaaactgc ttcattcgcggttcagtggtgcggtacgttcagcttcctgctgatgaagtggacacccag ctcctacaggacgcagcacgaaaagaggccatgcaacagaaacaatga

DBGET integrated database retrieval system