Colossoma macropomum (tambaqui): 118809746 Help Entry 118809746         CDS       T09004                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism cmao  Colossoma macropomum (tambaqui) Pathway cmao04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:cmao00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     118809746  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cmao04121]     118809746    03400 DNA repair and recombination proteins [BR:cmao03400]     118809746 Ubiquitin system [BR:cmao04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      118809746    Cul5 complex      118809746 DNA repair and recombination proteins [BR:cmao03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      118809746 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  118809746 NCBI-ProteinID:  XP_036429187 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRPPEDQRLYKDEQLLEDSKTLGDS GFTNQTARPQAPATVGLAFRISDDAFEPLQVEPFSNPPELPDVMKPQDSGSTANEQSVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgtttttaatgattaggcgtcataagacaacaatcttcaccgacgccaaagag tccactaccgtttatgagttaaagcgcatcgttgaggggatcctgaagaggccgcctgaa gaccagaggctttacaaggatgagcagctgctagaagacagtaaaacactgggagactcc ggtttcaccaaccaaacagccagaccacaggctccagctacagtaggattagccttccgc atcagcgatgatgcgtttgagcccctgcaggtggagccgttctccaaccctccagagctt cctgacgtcatgaagcctcaggactctggcagcacggccaacgagcagtcagtgcagtaa

DBGET integrated database retrieval system