Colossoma macropomum (tambaqui): 118811525 Help Entry 118811525         CDS       T09004                                  Symbol hrasa Name (RefSeq) HRas proto-oncogene, GTPase a   KO K02833   GTPase HRas Organism cmao  Colossoma macropomum (tambaqui) Pathway cmao04010   MAPK signaling pathway cmao04012   ErbB signaling pathway cmao04068   FoxO signaling pathway cmao04137   Mitophagy - animal cmao04140   Autophagy - animal cmao04144   Endocytosis cmao04150   mTOR signaling pathway cmao04210   Apoptosis cmao04218   Cellular senescence cmao04370   VEGF signaling pathway cmao04371   Apelin signaling pathway cmao04510   Focal adhesion cmao04540   Gap junction cmao04625   C-type lectin receptor signaling pathway cmao04810   Regulation of actin cytoskeleton cmao04910   Insulin signaling pathway cmao04912   GnRH signaling pathway cmao04916   Melanogenesis cmao05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cmao00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118811525 (hrasa)    04012 ErbB signaling pathway     118811525 (hrasa)    04370 VEGF signaling pathway     118811525 (hrasa)    04371 Apelin signaling pathway     118811525 (hrasa)    04068 FoxO signaling pathway     118811525 (hrasa)    04150 mTOR signaling pathway     118811525 (hrasa)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     118811525 (hrasa)    04140 Autophagy - animal     118811525 (hrasa)    04137 Mitophagy - animal     118811525 (hrasa)   09143 Cell growth and death    04210 Apoptosis     118811525 (hrasa)    04218 Cellular senescence     118811525 (hrasa)   09144 Cellular community - eukaryotes    04510 Focal adhesion     118811525 (hrasa)    04540 Gap junction     118811525 (hrasa)   09142 Cell motility    04810 Regulation of actin cytoskeleton     118811525 (hrasa)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     118811525 (hrasa)   09152 Endocrine system    04910 Insulin signaling pathway     118811525 (hrasa)    04912 GnRH signaling pathway     118811525 (hrasa)    04916 Melanogenesis     118811525 (hrasa)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118811525 (hrasa)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmao04131]     118811525 (hrasa)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cmao04147]     118811525 (hrasa)    04031 GTP-binding proteins [BR:cmao04031]     118811525 (hrasa) Membrane trafficking [BR:cmao04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     118811525 (hrasa)  Endocytosis   Macropinocytosis    Ras GTPases     118811525 (hrasa) Exosome [BR:cmao04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    118811525 (hrasa)   Exosomal proteins of colorectal cancer cells    118811525 (hrasa) GTP-binding proteins [BR:cmao04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     118811525 (hrasa) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  118811525 NCBI-ProteinID:  XP_036431668 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtataagctggtggtggtgggtgctggaggcgtgggcaagagtgctctcacc atccaactgatccagaaccacttcgtggatgaatatgaccctaccatagaggactcgtac aggaagcaggtggtgattgatggagagacgtgcctgctggacatcctggacacagcaggt caggaggagtacagcgctatgagggaccagtacatgaggacaggagagggtttcctctgt gtctttgccatcaataacaccaagtcttttgaggacattcaccagtacagggaacagatc aaacgggtaaaggactcggacgatgtgccaatggtgcttgtgggtaataaatgtgatctc ccagctcgcacagtggacacgcggcaagcgcaggagctagcacgcagctacggcatccca tacatcgagacttcagccaagaccagacaaggcgtggaggatgccttctacacactagta cgagagatccgacagcacaagctaaggaaactcaatcctccagatgaaagcggacaggac tgtatgagctgtcgctgtgtggtatcgtga

DBGET integrated database retrieval system