Colossoma macropomum (tambaqui): 118813278 Help Entry 118813278         CDS       T09004                                  Symbol rab7b Name (RefSeq) ras-related protein Rab-7b   KO K07897   Ras-related protein Rab-7A Organism cmao  Colossoma macropomum (tambaqui) Pathway cmao04137   Mitophagy - animal cmao04140   Autophagy - animal cmao04144   Endocytosis cmao04145   Phagosome cmao04148   Efferocytosis cmao05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cmao00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     118813278 (rab7b)    04145 Phagosome     118813278 (rab7b)    04140 Autophagy - animal     118813278 (rab7b)    04137 Mitophagy - animal     118813278 (rab7b)    04148 Efferocytosis     118813278 (rab7b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118813278 (rab7b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmao04131]     118813278 (rab7b)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cmao04147]     118813278 (rab7b)    04031 GTP-binding proteins [BR:cmao04031]     118813278 (rab7b) Membrane trafficking [BR:cmao04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     118813278 (rab7b) Exosome [BR:cmao04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118813278 (rab7b)   Exosomal proteins of other body fluids (saliva and urine)    118813278 (rab7b)   Exosomal proteins of colorectal cancer cells    118813278 (rab7b)   Exosomal proteins of bladder cancer cells    118813278 (rab7b) GTP-binding proteins [BR:cmao04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     118813278 (rab7b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA cobW ATP_bind_1 PduV-EutP nSTAND3 AAA_16 Septin AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha ATPase_2 AAA_5 ATP-synt_ab ABC_tran SRPRB AAA_14 NACHT DAP3 MCM Motif Other DBs NCBI-GeneID:  118813278 NCBI-ProteinID:  XP_036434408 LinkDB All DBs Position Unknown AA seq 205 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNNKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVDQAFQTIARNALKQESEV EPYDFPDQIKLRDDRPASSSDGCNC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcctctcgcaaaaaggtgctgcttaaagtgatcatcctcggggactctggggtggga aagacctctttaatgaaccagtatgttaataataagttcagcaaccagtataaggccaca attggagcggacttcttgaccaaagaggttatggttgacgacaggcttgtcaccatgcag atttgggacacagcagggcaggagcgtttccagtctctgggcgtggcgttctacagagga gcggactgctgcgtgctggtgtacgacgtcactgccccaaacacgttcaagactctggac agctggagggacgagttcctgatccaggccagcccccgcgaccctgagaacttccccttt gtggtgctcggcaacaagatcgacttggagaacagacaggttacaacaaagcgagctcag gcatggtgtcaaagcaagaacaatattccctattttgagaccagtgccaaagaagctatc aacgtggaccaggctttccagaccatcgctcgcaatgcactcaaacaggagtctgaagtg gagccatacgatttccctgaccagatcaaactaagagatgatagacctgcctcctctagc gatggttgcaactgctga

DBGET integrated database retrieval system