Colossoma macropomum (tambaqui): 118813600 Help Entry 118813600         CDS       T09004                                  Symbol nppal Name (RefSeq) natriuretic peptide A-like   KO K12336   natriuretic peptide C Organism cmao  Colossoma macropomum (tambaqui) Pathway cmao04081   Hormone signaling cmao04270   Vascular smooth muscle contraction Brite KEGG Orthology (KO) [BR:cmao00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     118813600 (nppal)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     118813600 (nppal)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cmao04052]     118813600 (nppal) Cytokines and neuropeptides [BR:cmao04052]  Neuropeptides   Unclassified    118813600 (nppal) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  118813600 NCBI-ProteinID:  XP_036434915 LinkDB All DBs Position Unknown AA seq 110 aa AA seqDB search MLSSVSVLCLCSLLLLNLAGAKPLSGLQTIKELLEEEQEANVPYLGTEDASMEHRGSSPE DSGNESALERVLGDLLAVSKRSWSRFKKGGLRSCFGVRLERIGSFSGLGC NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atgctctccagcgtctccgttctctgcctgtgctcgctgctgctgctcaacctggccggt gccaaaccgctctccggtctccagaccatcaaagagcttctggaagaggagcaggaagcc aatgtgccttatttgggcactgaagatgcgagcatggagcacagaggctcgagcccggag gattccggaaatgagagcgcgctggagcgcgtgctcggagacctgctggccgtgtccaag cgctcgtggagccgcttcaagaagggtggactgcgcagctgcttcggggtcaggctcgag cgcatcggctccttcagcgggctgggctgctga

DBGET integrated database retrieval system