Colossoma macropomum (tambaqui): 118813822 Help Entry 118813822         CDS       T09004                                  Symbol nras Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism cmao  Colossoma macropomum (tambaqui) Pathway cmao04010   MAPK signaling pathway cmao04012   ErbB signaling pathway cmao04068   FoxO signaling pathway cmao04137   Mitophagy - animal cmao04140   Autophagy - animal cmao04150   mTOR signaling pathway cmao04210   Apoptosis cmao04218   Cellular senescence cmao04370   VEGF signaling pathway cmao04371   Apelin signaling pathway cmao04519   Cadherin signaling cmao04540   Gap junction cmao04625   C-type lectin receptor signaling pathway cmao04810   Regulation of actin cytoskeleton cmao04910   Insulin signaling pathway cmao04912   GnRH signaling pathway cmao04916   Melanogenesis Brite KEGG Orthology (KO) [BR:cmao00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118813822 (nras)    04012 ErbB signaling pathway     118813822 (nras)    04370 VEGF signaling pathway     118813822 (nras)    04371 Apelin signaling pathway     118813822 (nras)    04068 FoxO signaling pathway     118813822 (nras)    04150 mTOR signaling pathway     118813822 (nras)   09133 Signaling molecules and interaction    04519 Cadherin signaling     118813822 (nras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118813822 (nras)    04137 Mitophagy - animal     118813822 (nras)   09143 Cell growth and death    04210 Apoptosis     118813822 (nras)    04218 Cellular senescence     118813822 (nras)   09144 Cellular community - eukaryotes    04540 Gap junction     118813822 (nras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     118813822 (nras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     118813822 (nras)   09152 Endocrine system    04910 Insulin signaling pathway     118813822 (nras)    04912 GnRH signaling pathway     118813822 (nras)    04916 Melanogenesis     118813822 (nras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmao04131]     118813822 (nras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cmao04147]     118813822 (nras)    04031 GTP-binding proteins [BR:cmao04031]     118813822 (nras) Membrane trafficking [BR:cmao04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     118813822 (nras)  Endocytosis   Macropinocytosis    Ras GTPases     118813822 (nras) Exosome [BR:cmao04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118813822 (nras)   Exosomal proteins of other body fluids (saliva and urine)    118813822 (nras)   Exosomal proteins of breast cancer cells    118813822 (nras)   Exosomal proteins of colorectal cancer cells    118813822 (nras) GTP-binding proteins [BR:cmao04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     118813822 (nras) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 ATP_bind_1 FeoB_N Septin TP0183_N Ldh_1_N Motif Other DBs NCBI-GeneID:  118813822 NCBI-ProteinID:  XP_036435268 LinkDB All DBs Position Unknown AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL ARTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIRHYRMKKLNSREDRKQGC LGVSCEVM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagctggtggtggtgggagcaggtggtgtggggaagagtgcactgacc atccagctcatccagaatcacttcgtggatgaatatgaccccaccatagaggactcgtac aggaagcaggtggtgatcgatggggagacgtgtctgctggacatcctggacacagcagga caggaggagtacagtgctatgagggaccagtacatgaggaccggcgagggcttcctttgc gtgtttgccatcaacaacaccaagtccttcgctgatgtgcatttgtatcgtgagcagatc aaacgggtgaaggactctgatgatgtgcctatggtgttggttggaaacaaatgtgatttg gccagaactgtcgacaccaaacaggctcaggaactagccaggagctacggcatagagttt gtagaaacttcagctaagaccagacagggagtcgaggacgccttttacaccctcgttcgg gagatccgccattatcgcatgaaaaagctcaacagccgggaggacaggaaacagggctgc cttggcgtctcctgtgaggtcatgtga

DBGET integrated database retrieval system