Colossoma macropomum (tambaqui): 118817038 Help Entry 118817038         CDS       T09004                                  Name (RefSeq) interleukin-8-like isoform X1   KO K10030   interleukin 8 Organism cmao  Colossoma macropomum (tambaqui) Pathway cmao04060   Cytokine-cytokine receptor interaction cmao04218   Cellular senescence cmao04620   Toll-like receptor signaling pathway cmao04621   NOD-like receptor signaling pathway cmao04622   RIG-I-like receptor signaling pathway cmao05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cmao00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     118817038  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     118817038  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     118817038    04621 NOD-like receptor signaling pathway     118817038    04622 RIG-I-like receptor signaling pathway     118817038  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118817038  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cmao04052]     118817038    00536 Glycosaminoglycan binding proteins [BR:cmao00536]     118817038 Cytokines and neuropeptides [BR:cmao04052]  Cytokines   Chemokines    118817038 Glycosaminoglycan binding proteins [BR:cmao00536]  Heparan sulfate / Heparin   Chemokines    118817038 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  118817038 NCBI-ProteinID:  XP_036439587 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MNSRVVGVCLLVAVFTLTEAGTNLSGLDLEPRCRCSGTESRRIGKLIESVELFPPNLHCK ETEIIATLKNTGQEICLDTKAPWVLKIIEKIMANRSP NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaacagcagagtcgtgggggtgtgtttacttgtggctgtcttcactctgactgaagca ggtacaaatctgagtggtctggatttggaaccccggtgccgctgcagtggaaccgagagc agacggatcggcaaactgatagagagcgtggagctcttccccccgaacctccactgcaaa gagacggagatcatagcgacgctaaagaacaccggtcaggagatctgtctggacactaaa gctccatgggtcctgaaaatcattgagaagatcatggctaaccggtcaccctaa

DBGET integrated database retrieval system